CAZyme Information: mRNA_M_BR32_EuGene_00104651-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00104651-p1
• CAZy Family: GH38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		49249.13	5.3343

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00014:531679-533159(+)

Full Sequence      

MTAANEKPLVVAMSLPGAGHTIPVMRAAAHLASRGFDVWFVTAADFESSALSSGIARFFP
SPSPFALHPDLMAGYMDLPEGPARLDFVFRNVFLRDTKQYAAALRGALETARAETPGRRV
VVLQDMFAGGALPFIHGAPPPKGYEDDGFPPVVSLNVSVLFCTSADAPPIGFPVDPAGRE
GEEVLRLHGEFNAGTAETRAMLNGILGEMGCTRRVEALADAWLEGPDLTLQLCSPGLEYR
RRDLSPKIRFVGGLPLPEGKGGPLPDWLREHVEAQRESHANGQAKRRKLVFVTQGTVDID
HSELLIPALQGLGAREDLFVVGVLGRKGARLPESVESSLPSANVKVLDYFSYNDILPHAD
VFVTNGGYGGFMHGVMNGSPMIIAGVSNDKGDVANRMENAGLGINLRTATPTPEQISAAV
DQVLADSSYKQRALEIKKENEEMDSFARIEKAVLEVAR

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00104651-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	193	457	1.4e-34	0.5575916230366492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.42e-34	10	455	3	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.26e-26	16	458	10	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	3.90e-20	13	442	1	375	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	4.23e-08	219	434	226	416	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	3.09e-06	334	438	338	444	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ58379.1|GT1	1.07e-167	1	457	1	450
CAK39187.1|GT1	2.52e-100	6	455	15	454
BCS13313.1|GT1	1.22e-97	5	455	14	453
BCS01597.1|GT1	1.22e-97	5	455	14	453
QUN04299.1|GT1	4.20e-87	10	457	21	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTG_A	4.38e-10	238	430	210	380	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
6J31_A	5.53e-10	343	439	280	376	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	5.59e-10	343	439	283	379	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
4LDP_A	1.15e-09	248	455	240	442	Spinosyn Forosaminyltransferase SpnP [Saccharopolyspora spinosa],4LDP_B Spinosyn Forosaminyltransferase SpnP [Saccharopolyspora spinosa],4LEI_A Spinosyn Forosaminyltransferase SpnP [Saccharopolyspora spinosa],4LEI_B Spinosyn Forosaminyltransferase SpnP [Saccharopolyspora spinosa]
6PNT_A	1.40e-08	261	458	238	433	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	2.09e-87	10	457	21	458	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E9L011|UGTB1_STABO	3.97e-67	4	457	2	431	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|E7CQW6|UGTA1_STABO	4.14e-56	1	457	1	435	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	1.03e-31	10	439	5	403	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|Q6UWM9|UD2A3_HUMAN	2.07e-08	246	438	270	445	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00104651-p1.