CAZyme Information: mRNA_M_BR32_EuGene_00102661-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00102661-p1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42919.53	6.6566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00013:1064131-1065364(-)

Full Sequence      

MKTLYLAALVLGLASAGPQSNLARMADTFIRIGVRKVFYYNEATLYTAFEAAYNLTGNST
LVSWYRDQIDDAVVLPDGTIRDWRLDYYSLDDYRIGNNLLWWYQRTGEAKYRAAADTIRR
QLDRHPRTPSGGFWHRAPVYEDQMWLDGIFMADSFYARWTALFDGDNATAWDDIARQFDN
IESRTRNQTTGLLVHGYDEAKRAVWADPVTGAAPLVWGRAVGWYFLALTEVIPLMPAAHP
GRERLVRYFVTLAEGLKKAQDRGSGGWWLVMSEPYPGREGNYLESSAAAMFTAGLLRGMK
LGLLETRKFRCTADRAYQHLVERFVTEGEDGTITWEGTVQVGSLSGNGTYEYYISIPVVR
NDARGGGAFMLASYVMATLK

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00102661-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	39	376	1e-97	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	4.37e-68	37	379	40	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.44e-61	40	380	29	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64405.1|GH105	2.08e-284	1	380	1	380
USW51507.1|GH105	4.78e-172	1	373	1	373
UJO20915.1|GH105	4.49e-160	18	373	43	399
EAA61616.1|GH105	4.52e-159	13	374	10	374
QBZ53569.1|GH105	4.55e-157	23	373	42	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	9.95e-75	25	379	8	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.01e-44	89	372	86	360	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.58e-44	89	372	76	350	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	7.75e-08	39	320	38	307	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.03e-43	89	372	86	360	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	6.24e-30	172	372	20	224	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	6.24e-30	172	372	20	224	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	2.66e-11	88	376	134	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999705	CS pos: 16-17. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00102661-p1.