CAZyme Information: mRNA_M_BR32_EuGene_00101411-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00101411-p1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612	BR32_scaffold00013|CGC1	65019.88	4.4971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00013:704985-707078(-)

Full Sequence      

MRPSYAALPCLAIAAANPEVFDYVIVGGGTAGLVVANRLSENPNVRVAVIEPGGDERNNP
NVTLVTSYLNMSAFDTPIDWAYETVPQVGINGEPQIYHQGKAIGGTSAINAMAYIRSNKA
DIDAWEKLGNPGWNWDNLYPYSLAAENFSIPGPGLQASGVTFDPAFHGVSGPIRTGWGND
FSNLTLTPRLRDAWRELGLPSNLDTGGGDNHGVSTNPLTAQAGPPDIRWDAARGYWYPVE
DRPNLTIIKGTVWRLVWRDGDAASGKGAVSASGVEYLDQDGQVAVLAATKEVVVAAGSLR
TPLVLESSGVGNPGILENLGIPVVVDLPGVGENLQEQGNNRVVYSTTPEAAGTGISQTWA
SPADIFGSDLADVASRTRDELPRWADQIVSASAATGALLNRTAVEAVLRAQHELVFGGAA
AEGNATTLTEFVTQSLGTGVLIVSHWTLFPFSRGSVHLASADVARIDEPRIDPRLNLVEF
DIRAQTQAARLGAQLAKTGSLSGLVAGRVQPSPEVLPEDATDDQWRDYIRTTSGIAYHNI
GTASMMSRDLGGVVDPELKVYGTANVRVVDMSIIPMQLTGHPIAMLYAVAERAADIIKQS
PLYSQPRDLESL

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00101411-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	599	4.1e-156	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.38e-80	19	602	4	537	choline dehydrogenase; Validated
225186	BetA	3.33e-79	19	598	6	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.73e-48	22	597	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	9.85e-35	450	593	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.86e-28	91	335	15	214	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59989.1|AA3_2	0.0	1	603	1	603
CDP31277.1|AA3_2	3.76e-316	10	604	16	607
BBD84647.1|AA3_2	1.06e-176	19	600	19	593
BCS18414.1|AA3_2	6.40e-155	21	600	36	599
BAV89806.1|AA3_2	3.13e-151	21	598	19	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.18e-136	17	599	2	566	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	4.62e-96	17	598	13	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5NIT_A	2.41e-92	22	597	19	573	Glucose oxidase mutant A2 [Aspergillus niger]
1CF3_A	4.99e-92	22	597	21	575	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]
5NIW_A	1.31e-91	22	597	19	573	Glucose oxydase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13006|GOX_ASPNG	4.51e-91	22	597	43	597	Glucose oxidase OS=Aspergillus niger OX=5061 GN=gox PE=1 SV=1
sp|Q5AUN2|XPTC_EMENI	9.72e-85	21	598	38	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.91e-81	22	599	41	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P81156|GOX_PENAG	7.55e-80	19	597	23	579	Glucose oxidase OS=Penicillium amagasakiense OX=63559 PE=1 SV=1
sp|Q92452|GOX_TALFL	8.61e-79	19	597	41	597	Glucose oxidase OS=Talaromyces flavus OX=5095 GN=GOX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.850885	0.149152

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00101411-p1.