CAZyme Information: mRNA_M_BR32_EuGene_00099781-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00099781-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		51333.97	6.5002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00013:310492-311916(+)

Full Sequence      

MRPTLLTAALAVAPALAYPGMGTPEQNKQVRAAMAAGENFHDKLVRDITKASSNIKQPRQ
CSKRCEGTDNDDAEDGDEEVDGADGGRDPDENHHLDSLELIGDLIGMPNNKLSSTGFAIK
ELLTTTGGAPESGEAYRPGELARKGTAACAKDTCCIWKYVADDMVPIFRGNSGRCTNLAR
AAIRMGFHDAGGWSRTTGPLGGADGSLILAPEEILRSDNRGLEEIVAQTKQWYAQYSRYG
VGMADLVQFAANVATVVCPLGPRVRTFIGRKDSSVPSPKGLLPPVDGSADFLIEMFRNKT
IEPHGLTALLGAHTTSQQRFVDPSRAGDPQDSTPGVWDILYYQQTLNQVPTPQRVFKFQS
DVVLSQHPLIKQEFSLFAAKDNGQSHWNFDYAREYIRLSLLGVNNINTLTECTKSLPPRI
RAFSAPDEDLVSKWLQGGIAGETARKIMNGDSLNGGKGILSLVSGLLGKLKSRF

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00099781-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	160	403	5.5e-52	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	3.90e-110	145	426	6	297	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173823	plant_peroxidase_like	1.59e-23	183	368	22	226	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	3.65e-20	177	314	14	150	Peroxidase.
178218	PLN02608	2.81e-13	177	425	29	266	L-ascorbate peroxidase
178467	PLN02879	1.09e-10	179	402	34	246	L-ascorbate peroxidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59830.1|AA2	0.0	1	467	1	467
CCF45286.1|AA2	8.64e-169	1	474	1	417
UQC76336.1|AA2	7.99e-129	97	453	43	398
QRD06638.1|AA2	2.55e-121	97	437	44	379
QDS77259.1|AA2	5.34e-120	96	438	45	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BM1_A	3.00e-28	144	421	6	295	CRYSTAL STRUCTURE OF MANGANESE PEROXIDASE 4 FROM PLEUROTUS OSTREATUS - CRYSTAL FORM I [Pleurotus ostreatus],4BM1_B CRYSTAL STRUCTURE OF MANGANESE PEROXIDASE 4 FROM PLEUROTUS OSTREATUS - CRYSTAL FORM I [Pleurotus ostreatus],4BM2_A Crystal Structure Of Manganese Peroxidase 4 From Pleurotus Ostreatus - Crystal Form Ii [Pleurotus ostreatus],4BM3_A Crystal Structure Of Manganese Peroxidase 4 From Pleurotus Ostreatus - Crystal Form Iii [Pleurotus ostreatus],4BM4_A Crystal Structure Of Manganese Peroxidase 4 From Pleurotus Ostreatus - Crystal Form Iv [Pleurotus ostreatus]
1LY8_A	2.16e-27	139	426	7	306	Chain A, Peroxidase [Coprinopsis cinerea],1LY8_B Chain B, Peroxidase [Coprinopsis cinerea]
3Q3U_A	2.72e-27	154	417	15	289	Trametes cervina lignin peroxidase [Trametopsis cervina]
5FNB_A	3.30e-27	150	417	10	283	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii],5FNB_B Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii]
2VKA_A	1.24e-26	150	417	10	283	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20013|LIGC_TRAVE	2.90e-25	145	417	32	319	Ligninase C OS=Trametes versicolor OX=5325 PE=1 SV=2
sp|P28314|PER_COPCI	3.47e-25	139	426	27	326	Peroxidase OS=Coprinopsis cinerea OX=5346 GN=CIP1 PE=1 SV=2
sp|P28313|PER_ARTRA	4.80e-25	139	426	28	327	Peroxidase OS=Arthromyces ramosus OX=5451 PE=1 SV=3
sp|O94753|VPL2_PLEER	8.53e-25	150	417	40	313	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1
sp|Q9UR19|VPL1_PLEER	8.53e-25	150	417	40	313	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000321	0.999648	CS pos: 31-32. Pr: 0.2977

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00099781-p1.