CAZyme Information: mRNA_M_BR32_EuGene_00098881-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00098881-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	BR32_scaffold00013|CGC5	28500.95	5.0746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00013:68030-68950(-)

Full Sequence      

MFNSIPHFLLMTSGVGIALMPQVMAVRTMIPCTSFDNQSNFDADWNYNYPWGTDHNGAAR
MDGANAVRLASRGDRTLVITARRAEGLPPATHGGQQIPIRYLSGAIHAKEQFTVRPNGGY
DFTGEFKATTTKGTWPAFWLTGVDSWPPEIDMAEWKGSGKISFNTFNTSSEVVSRDVDYP
APDQFHSIKCEVRDEGQDVRANFYMDGNLLTTQIGKGYVGKPLFLIINLQMEGSSGTPGP
ESDTEYAIRNLEVLSYNP

Enzyme Prediction     

EC	3.2.1.181:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	43	239	1.7e-83	0.9897959183673469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185693	GH16_laminarinase_like	8.92e-15	35	246	5	223	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	2.44e-10	35	246	3	200	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	1.29e-04	127	244	126	250	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185690	GH16_fungal_Lam16A_glucanase	4.44e-04	133	154	95	117	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185691	GH16_Strep_laminarinase_like	0.003	37	234	19	233	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59743.1|GH16_10	4.38e-195	1	258	1	258
UQC81933.1|GH16_10	1.77e-122	2	258	43	294
AEO58155.1|GH16_10	9.87e-95	9	225	10	218
AEO69030.1|GH16_10	5.30e-93	1	225	4	222
EAW17385.1|GH16_10|3.2.1.181	6.21e-90	17	254	7	243

PDB Hits     

mRNA_M_BR32_EuGene_00098881-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F7J1C8|E3GAL_FLAVE	8.81e-71	28	253	23	244	Galactan endo-beta-1,3-galactanase OS=Flammulina velutipes OX=38945 GN=EN3GAL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.337728	0.662250	CS pos: 25-26. Pr: 0.6204

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00098881-p1.