CAZyme Information: mRNA_M_BR32_EuGene_00090881-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00090881-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		46347.50	6.5867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00011:122990-125028(-)

Full Sequence      

MRFSGIVATLVAGAGVSAHPGDYSKLERRAVATSEPHYPQPWMNPDADGWQEAYVKAKDF
VSQMTLLEKVNLTTGVGWASDLCVGNVGAVPRLGLRSLCLQDSPTGVRFADWVSVFPAGI
TTGATFDKGLMYRRGQAMGQEAKDKGINVLLGPVAGGLGRVAAGGRAWESFGADPVLTGY
GMIETIKGIQDTGVIATAKHFIGNEQEHFRQVGEERGRGINISESLSSNIDDKTMHELYL
WPFADAVRAGVGSVMCSYTQVNNSYGCQNSKLLNGLLKDELGFQGFVMSDWQAQHTGAAS
AAAGLDMSMPGDTEFNTGLSFWGANLTLAVVNGTVAEWRIDDMAMRIMAAFFKVGNTLDQ
PEINFSSWTKDTFGPLHSSSGNRIQQINQHVDVRRDHGNLIREVAAKGTVLLKNTNNALP
LNKPKFLAVI

Enzyme Prediction     

EC	3.2.1.21:43	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	89	310	6.5e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.71e-47	89	423	54	352	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.14e-35	40	347	11	313	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	4.34e-23	114	430	118	416	beta-glucosidase BglX.
178629	PLN03080	3.34e-22	56	430	52	426	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	0.006	409	430	1	23	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54575.1|GH3	4.36e-314	1	430	1	430
AAX07690.1|GH3|3.2.1.21	6.19e-314	1	430	1	430
VBB86328.1|GH3	1.04e-224	1	430	1	428
CAP68372.1|GH3	8.40e-224	1	430	1	428
CDP31843.1|GH3	8.40e-224	1	430	1	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NBS_A	4.66e-216	19	430	6	416	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
6SZ6_A	1.97e-207	32	430	2	397	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	2.40e-174	31	430	4	402	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5FJI_A	8.21e-170	31	421	3	393	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
4IIB_A	6.76e-168	31	430	3	402	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUD6|BGLA_ASPOR	1.07e-173	7	430	8	421	Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglA PE=1 SV=1
sp|B8NRX2|BGLA_ASPFN	3.02e-173	7	430	8	421	Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglA PE=3 SV=1
sp|B0XPE1|BGLA_ASPFC	3.81e-171	1	421	1	422	Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglA PE=3 SV=1
sp|Q4WJJ3|BGLA_ASPFU	3.81e-171	1	421	1	422	Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglA PE=1 SV=1
sp|D0VKF5|BGLA_ASPTE	2.16e-170	1	421	1	412	Probable beta-glucosidase A OS=Aspergillus terreus OX=33178 GN=bglA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.028804	0.971184	CS pos: 18-19. Pr: 0.9322

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00090881-p1.