CAZyme Information: mRNA_M_BR32_EuGene_00090361-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00090361-p1
• CAZy Family: GH29
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		66193.86	5.0351

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:1386947-1389020(-)

Full Sequence      

MACRARTSLLWTLATASMALGVAVPRSVHQARQIQEASELLEAYDYVIVGGGTAGLTVAD
RLTEDPATTVLVLEAGVMGDPAEVLPATAGGSGWTLPAWKFQSVPQANLGGRTSLVWLGN
VVGGGSAVNAMMAARGSAEDYDRWGRPFGDDDGGWNWEGILPYFKKGLKMNPPPADLANQ
FNISIDAANWGTDSPVQVGFPSFQYPGLKPLVKAFTEMPGVEFVKDSGAGGAGVYWFPTL
MDPNKVERSYAGNAHYSNLDRPNYHLMVETTVRRVLLDDTTATGVEFTKAGSIATVEATR
EVLIAAGAIHTAKVLMLSGIGPREAIEAAGQDTVVDLPGVGQNFQDHANLGAAITLAGLK
QIHPNPDDLGEGGDAKFQRWSDAVWAANRTGPRSIAYGNIAGWLPLTAISPDRHEALAAE
LEAQDHAAHLPADAHPTVAAGYAAQMKGLAAAMRSKNTVFARYALNAATGATAPILNQPF
SRGTVALDPRDPFGALPLVDYRALSNPVEVAVSVELVKWYRRFHFDTSLRALGPRETAPG
PDVVTDRQIADWLATAYAPSDLHPVGTAAMLPLELGGVVDTTLRVYGVDNLRVVDSSIMP
SLPGGNTCQPTYAIAEKAADIIKSGV

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00090361-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	43	624	2e-159	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.28e-94	42	623	4	532	choline dehydrogenase; Validated
225186	BetA	5.04e-85	37	624	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.37e-32	479	618	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.17e-23	107	347	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.57e-08	42	346	54	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63758.1|AA3_2	0.0	1	626	1	626
CEI67552.1|AA3_2	1.01e-272	8	624	4	618
CCT76262.1|AA3_2	8.74e-265	11	624	7	611
QGI88770.1|AA3_2	1.38e-259	11	624	7	633
AEO63808.1|AA3_2	6.29e-200	20	625	18	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	8.00e-104	44	623	6	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	3.19e-103	16	622	12	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	1.09e-65	44	623	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	6.92e-64	44	624	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.65e-63	44	624	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	3.07e-103	44	623	38	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.38e-72	42	622	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.38e-72	42	622	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	2.90e-69	45	623	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	4.73e-65	44	625	41	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.616966	0.383028

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00090361-p1.