CAZyme Information: mRNA_M_BR32_EuGene_00089981-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00089981-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		43001.15	8.2879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:1312301-1313422(-)

Full Sequence      

MRAHLPHRRRVLTWLGYAISAGVIFWLLYIVVRLLAFAQLFGKLGPHAGIAVTQSQVLEA
HANHAEPVIPRIIHQIYHNWKDPTSKQLPEDWEAARQTCIDKNPGWDVKVGASSQQSISR
PSRLTCCQIWHSQDSLAFIANEYPWFLSTYEGYKYPIQRVDVMRYFLVRKYGGIYIDLDN
GCEASLEPFRSLPAFTTDGGLGALSNNIIGAQPEHPWTRMLTENLEAYNWNWLLPYARVM
YNSGQWYLTAMWEQYHARLREGSVAPYPGSNWAKLHRVMMDEREGADRWVFWNHAGHGGT
WGAGDDWFWAWLGRHWIEAVVEAIAAVVALLTSFACCLKCARRRRLRRIVDRGYKYAKVE
DDVDVELLGGRYC

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00089981-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	190	5.5e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.07e-28	66	267	79	255	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.97e-14	89	188	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63730.1|GT32	2.31e-284	1	373	393	765
QBZ58620.1|GT32	3.26e-102	12	356	14	338
QGA12364.1|GT32	1.56e-93	1	338	1	313
UNI16793.1|GT32	6.88e-87	27	349	27	326
AEO56548.1|GT32	3.52e-85	11	346	16	327

PDB Hits     

mRNA_M_BR32_EuGene_00089981-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	3.18e-40	68	255	54	216	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.92e-40	68	255	61	223	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.02e-36	69	252	57	215	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.28e-35	66	259	79	247	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.57e-22	69	349	64	307	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000010

TMHMM  Annotations     

Start	End
13	35
316	338