CAZyme Information: mRNA_M_BR32_EuGene_00089901-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00089901-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	BR32_scaffold00010|CGC2	24427.34	7.8425

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:1295062-1295894(-)

Full Sequence      

MLFPSALLLAAPLVLAAPAALEERQAPCQDVHVFLARGTSEPYPGRQELTVNAICKGISS
CGSEDIQYPAAFNPTYCASVDQGVSNGINQVTAYASRCPNSKLVLSGYSQGAHVVGDILG
GGGGSFQGCTQRTVQGLNPTTSPGNKIKAALLWGDVRHTANQAYNTNTGASRTGTWPRSG
SQLTSLNRFSNVLRAICVSTDPVCAGGQDGNSHTTYFNLFSEDAAAWVKTKLN

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00089901-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	232	1.5e-43	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.41e-29	27	232	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63722.1|CE5	8.77e-168	1	233	45	277
QGI63982.1|CE5	3.16e-100	12	229	14	231
QGI81251.1|CE5	3.16e-100	12	229	14	231
CCT68028.1|CE5	3.16e-100	12	230	14	232
CZS83092.1|CE5	3.67e-99	12	232	14	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	6.78e-26	28	232	2	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	6.78e-26	28	232	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	6.78e-26	28	232	2	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	6.11e-22	28	233	2	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
4PSC_A	2.52e-10	22	155	73	193	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	6.43e-25	28	232	29	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	1.09e-24	5	233	4	230	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.73e-20	28	233	33	238	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|B9U443|CUTI1_COPCI	5.40e-11	7	114	9	121	Cutinase CUT1 OS=Coprinopsis cinerea OX=5346 GN=CUT1 PE=1 SV=1
sp|O06319|CULP4_MYCTU	1.08e-10	10	232	29	226	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999769	CS pos: 24-25. Pr: 0.8645

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00089901-p1.