CAZyme Information: mRNA_M_BR32_EuGene_00089851-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00089851-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449		48587.36	6.0213

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:1280190-1281539(+)

Full Sequence      

MRLSTSTKSTRIGGVRIHALQQVIELDSGNNSIISLMSVPDNDVVQPSALRSIAAQMAIV
VPCMDEDIATIEGVLSGIPHESLVILVSNSSHIEAYDREMDALHRFSRISHRSAIAVHQQ
DPGLAAAFLTAGMPELVDPTTQRIRNGKGEAMLVGAALAAATGRRYVGFIDADNFVPGSV
REYCEAFAAGLHLAQAGRQTGKAMVRLSWGSKPKVRDGKLEFAKEGRSSRITNRWLNRLL
SEIGAKDSDIIATGNAGEHAMSIELALKMCFAGGFAVEPFQYLDLLEQFGSSHEGCSSKN
AAGRHWNDLVEVLQIETRNPHLHQDKGDDHIKDMWAQALGVIHRSAVTPTQLRQLIEFFV
AENDARMPGPGETRVYPPIESLDLLQLWESLEEASALKVCGDPMGIDFAGTELTLGVVTL
LEGVKECISGITRDLLTKTGGGCSMAGRR

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00089851-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT55	6	391	6.1e-155	0.9895561357702349

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401440	Osmo_MPGsynth	0.0	8	391	4	380	Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth). This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP) EC:2.4.1.217, comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
237735	PRK14503	1.22e-137	1	395	1	385	mannosyl-3-phosphoglycerate synthase; Provisional
162866	osmo_MPGsynth	5.42e-120	2	384	1	373	mannosyl-3-phosphoglycerate synthase. This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together mannosyl-3-phosphoglycerate phosphatase (MPGP) comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
184713	PRK14502	9.45e-106	1	384	1	378	bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63715.1|GT55	0.0	1	449	49	497
UQU66149.1|GT55	5.65e-132	1	392	1	387
AVT34790.1|GT55	1.06e-124	1	401	1	391
AVT37307.1|GT55	1.06e-124	1	401	1	391
QSB13607.1|GT55	5.29e-115	1	398	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WVK_A	1.25e-87	1	391	1	381	Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVK_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVL_A Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVL_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]
2WVM_A	3.91e-86	1	391	1	381	H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVM_B H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]
2ZU7_A	7.16e-74	13	396	13	386	Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU7_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UZC1|MPGS_PYRAB	4.72e-81	13	395	13	386	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=mngA PE=3 SV=1
sp|O58689|MPGS_PYRHO	4.10e-79	13	396	13	386	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=mngA PE=1 SV=1
sp|Q8U380|MPGS_PYRFU	4.10e-79	13	395	13	386	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=mngA PE=3 SV=1
sp|Q9YDM5|MPGS_AERPE	1.44e-57	1	356	1	343	Mannosyl-3-phosphoglycerate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=mngA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00089851-p1.