CAZyme Information: mRNA_M_BR32_EuGene_00089471-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00089471-p1
• CAZy Family: GH27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		45815.20	4.9505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:1168242-1169618(+)

Full Sequence      

MSLVNLSRSALALLLAASNFAGVNAFPAASDVAAAATQGPAGKVSTGYFAGYHAKRKGVT
FGVDQIPWDKYDDVKYAFAETTADGSLDLSKSAPEELPKFVDAAHAHGKKAQVALGGWAG
SIHFSSNVGSPENRTAFVKTCLDLVQKYNLDGLDFDWEYPNKQGLGCNAISPNDTANFIS
FLTELRKAQPKPLLLTAAVSLYPYNDAAGQQSANGALKPMGDLLDYSIIMGYDVFGAWAP
TGGPNAPLEQACDPRNNQGGIKEGVAKWVAAGVPAEKLILGIGAYGHGFTVSQADAFVPT
TDGKPFPLSAYPKNNGTRRQGSSWDDDPAVDACGAAQPAGGTFTFWSMVTEGQFLDESGK
PRAGIAYGYDDCSQTPFVYNNATSWWVSYDDSKSLGVKGKYITDNKLAGFSVWELGGDYK
NIVVDAMRGSVGL

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	43	421	1.4e-65	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	8.05e-65	47	418	4	334	Glyco_18 domain.
119365	GH18_chitinase	2.08e-59	47	418	3	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	9.06e-58	47	418	4	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	9.38e-53	110	415	72	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	3.96e-52	61	428	55	433	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63682.1|GH18	0.0	1	433	1	433
UQC81261.1|GH18	2.39e-187	42	433	30	414
UPK94240.1|GH18	2.19e-160	44	433	28	409
CEI61705.1|GH18	2.93e-151	33	433	19	411
QPC70652.1|GH18	3.37e-150	44	433	30	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	3.22e-56	66	428	17	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	2.30e-37	110	428	124	416	Chain A, Glycosyl Hydrolase [Niallia circulans]
3WL1_A	2.47e-33	48	418	12	359	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
6BT9_A	4.11e-33	99	418	149	448	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
3WKZ_A	6.48e-33	48	418	12	359	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	2.14e-35	110	428	156	448	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	3.54e-31	48	415	27	362	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q9BZP6|CHIA_HUMAN	3.72e-31	110	415	91	362	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
sp|P36362|CHIT_MANSE	4.98e-30	48	418	28	375	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q11174|CHIT_CAEEL	4.43e-29	110	418	130	399	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000288	0.999685	CS pos: 35-36. Pr: 0.4698

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00089471-p1.