CAZyme Information: mRNA_M_BR32_EuGene_00089121-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00089121-p1
• CAZy Family: GH27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		42169.84	5.4793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:1068710-1069903(+)

Full Sequence      

MRNSFSLFTALAAVAAAQNYLGFNSGSTKADYSVKVKADFLQEFTTAQNLEGAPGTFNAV
RLYTNIQGGTTDDPISAFEAAIETKTKILLGVWTSGTTSIEKELNALQKAVKQYGSKFTD
LVIGISIGSEDLYRNSVTGMTNKAGVGAQPDQLVAFIGDFKKAFKDTPLGKTPVGHVDTW
DVWPNATNKAVLDAIDWVGVDEYPYYENGKGNNIKNSGNLFDKAFNATIQAAGGKPVWVT
ETGWPSSGPDWDQAVPSIENAKYYWQEIGCRQLFNKVPTFWYNLRDSNPDNKQQFAITKN
LSTKPLFDLKCPTSFDIDKQRQANSPSSSSSSGNSTGGSNSSTPSSTNGSSNSGSNSSPA
AAGATSKAPSNAAGILEVLPVAAYAGLAVIGGALAMY

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00089121-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	73	291	2e-18	0.797427652733119

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.28e-28	21	270	46	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.83e-10	88	288	67	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63646.1|GH17	1.10e-258	1	397	1	397
CAY05225.1|GH17	9.60e-253	1	397	1	397
CDP32718.1|GH17	1.57e-176	8	328	4	331
CAP65657.1|GH17	1.57e-176	8	328	4	331
VBB87201.1|GH17	1.57e-176	8	328	4	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.24e-15	57	286	59	268	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	7.58e-15	57	286	59	268	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUZ1|EGLC_ASPOR	2.64e-96	20	314	20	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	1.44e-95	7	314	7	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	5.06e-95	10	314	10	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	5.70e-95	10	314	10	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	2.27e-94	10	314	10	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999725	CS pos: 17-18. Pr: 0.9612

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00089121-p1.