CAZyme Information: mRNA_M_BR32_EuGene_00088431-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00088431-p1
• CAZy Family: GH24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649		70665.42	5.6871

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:846915-848864(-)

Full Sequence      

NVWLTKVNPTHVGHWGTYIKTKDVSSESATVDLAVTLESTSKQESKVVVTTDVHVLDASG
QPGAKVASFGNATVTVPAGSSSSTNGTVTISNPALWGPKPDQTPNLHVAVTSVYSSDGEL
LDTYKTNFGIRNLQYTNDGLHVNGKRVYLQGVCQHHDLGSLGSAFHVPAARRQLEMLQDM
GSNAVRTSHNPPAPELLELADHMGMLVLDEIFDTWSIHKVENDFASIWNDWSEPDLRAFV
RRDRNHASVWAWSYGNEVREQLTEGGERTAQRLAGIAHEEDATRSSSVGMNNAGPGSPFT
AVVDLIGLNYQGEGKTGTRPSFPNFRSIYPNKMIYSTESSSVVSSRGTYVFPVPSENSAV
VNITTAVGVINDTRQVSSYELHGVEWGASPDKVFAGQDEFPYVGGEFVWTGWDYIGEPTP
YDDESRSSYFGIIDLAGFPKDRFYLYQARWAAAKPMAHILPHWNWAGREGQVTPVHVFSS
GDEAELFVNGKSQGRKTRGQLEYRFRWDDVAYAPGEVHVATYKGGAPWANATVRTTGAPT
TLSLSSYKEQKTLRADGSDLAFLSVAVTDDQGDVVPTAEPEVRFSVSGPAEIVSTDNGNP
TDFVPFPSHTRKAFRAKALVIVRAKEGAGRIVVTAEADGLKKGEFVLNA

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	1	483	6.8e-69	0.46808510638297873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408349	Glyco_hydro2_C5	6.04e-39	549	644	6	101	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
225789	LacZ	1.72e-38	10	469	179	619	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	1.78e-27	17	309	182	470	beta-D-glucuronidase; Provisional
406696	DUF4982	1.14e-22	470	529	1	60	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
236548	lacZ	1.72e-21	28	257	238	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63581.1|GH2	0.0	1	649	272	928
CDP26753.1|GH2	3.37e-314	1	648	219	867
CAP70161.1|GH2	3.37e-314	1	648	219	867
VBB76852.1|GH2	1.93e-313	1	648	219	867
AEO59435.1|GH2	2.15e-260	1	649	228	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	4.41e-145	1	648	171	819	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	3.94e-129	1	647	152	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	5.02e-120	1	640	158	798	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	5.05e-104	1	641	152	845	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	9.04e-104	1	641	175	868	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	2.59e-136	1	649	190	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	3.93e-67	2	641	194	813	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	1.39e-35	1	590	187	738	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	7.95e-31	90	498	271	677	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	3.63e-29	88	593	226	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000013

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00088431-p1.