CAZyme Information: mRNA_M_BR32_EuGene_00086641-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00086641-p1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		36918.73	9.6703

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:324717-325700(+)

Full Sequence      

MAAKLRRRTVSKLFWACGLLTVIYLVLRLRDTTAWAANGVILPPSWKPTWTLKDSIGSAT
SSGSSAEPAIPDGIPKKLWYKVGRAGVRKNIKPYIKSCLKNPGYDVEFLTDVSGDEFVKK
HYSWNPNIINRFLPISIPIIKADLLRYLILYEKGGIWNDLDVSCEAPIDEWIPEQYKSTA
ATVVGMEFDTDRWLRQIASWTIMAKPKQPHFLMAVEDCLEEVAATAKRLGTPISELKRNQ
LDDIIDLSGPRRLTRSIFKSLSKSLNREVGNNDIVNVTEPRLLGNVLILPDHSFADSMNM
WWGDKVPGRKLVVHHYAGSWKNEKGGE

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00086641-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	174	1.8e-20	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	4.25e-15	94	176	7	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	5.79e-15	74	322	82	346	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
368570	Caps_synth	1.55e-04	95	287	65	239	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63395.1|GT32	3.00e-248	1	327	1	327
QBZ66259.1|GT32	3.49e-127	1	327	1	329
QQK44540.1|GT32	5.86e-85	61	327	47	317
CAE7002672.1|GT32	3.28e-83	50	327	40	332
CAE7026497.1|GT32	1.43e-81	73	327	51	311

PDB Hits     

mRNA_M_BR32_EuGene_00086641-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.72e-24	74	323	99	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	8.32e-22	74	323	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	2.44e-17	52	287	80	352	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.17e-15	100	322	157	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P33300|SUR1_YEAST	1.69e-08	51	216	34	184	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.721496	0.278526

TMHMM  Annotations     

Start	End
13	27