CAZyme Information: mRNA_M_BR32_EuGene_00085881-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00085881-p1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		63315.00	9.6320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00010:89751-91622(+)

Full Sequence      

LAALIFPLGVNCYYEPLFNFVSVHKLTNSSNDLPIYKNPTYCVDDRVEDLVKRITIEKKA
GQFFQTMIFQGPRGIFDKRGERRNNTENIIAEKLITHFNIANEIIDAKETAQFVNLVQQR
ALNIRFGIPVTISSDLRHSFTDNFGIGMRAGAFSQWPESLGFAALRDPHLVGPHNVTTVT
KYFPGGGPIKNGEDFHFAYGKDQIYPGNNFEYYLTFFKTVIAAGTRQIMPYYLRPFGTKY
DPVGFFFNKQIVICFLRETFGFKGIVFSDWGLITDIVILGQDMPARAWGVQHLSELDRAL
RIFDAGINQFGGEARFELVVQLVKKGNVSESRIDVSVKRLLREKFLLGLFKNPFVDPKAV
RSIVGNDYFVRFGQDAQRKAYILLINKNELLPFKGPRVNISTKFYIEGFNVTTLENRNFL
VVKTPKKADYAFLRLQALYEPRPGGFESRFHAGSLEFNATEKVRQAAIYKAVPTVVDIML
NRPAVISEVAKGAAAVFGSFGSGTEVFLDVIFGIAAPEGKLPFDLPRSQKAVEELMEDVP
FNIKSPVFTFGYGLRYGRCAI

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.08e-25	54	409	1	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.38e-16	164	556	191	648	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.66e-15	55	342	1	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	5.12e-05	421	556	84	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
235417	PRK05337	4.67e-04	146	269	132	249	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ66666.1|GH3	0.0	1	561	7	630
QBZ61755.1|GH3	2.07e-260	1	556	8	619
UQC87911.1|GH3	2.77e-252	2	561	11	636
AUM60063.1|GH3	2.19e-239	25	559	40	637
QRD86843.1|GH3	5.51e-232	24	560	30	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	5.68e-21	34	557	38	615	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6JGE_A	3.94e-19	32	554	5	601	Crystal structure of barley exohydrolaseI W434A mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6K6V_A Crystal structure of barley exohydrolaseI W434A mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6KUF_A Crystal structure of barley exohydrolaseI W434A mutant in complex with glucose. [Hordeum vulgare subsp. vulgare],6L1J_A Crystal structure of barley exohydrolaseI W434A mutant in complex with 4'-nitrophenyl thiolaminaritrioside [Hordeum vulgare subsp. vulgare],6LBB_A Crystal structure of barley exohydrolaseI W434A mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare]
1LQ2_A	5.14e-19	32	554	1	597	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	5.18e-19	32	554	1	597	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
6JGL_A	5.23e-19	32	554	5	601	Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGN_A Crystal structure of barley exohydrolaseI W434H in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGO_A Crystal structure of barley exohydrolaseI W434H mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6JGP_A Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NGU6|BGLC_ASPFN	9.79e-233	24	560	30	627	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q2UFP8|BGLC_ASPOR	6.03e-230	24	560	34	631	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|Q5BCC6|BGLC_EMENI	2.31e-217	33	556	35	615	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q46684|BGLX_DICCH	7.60e-77	21	556	39	654	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	5.51e-23	20	558	16	640	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.820048	0.179981

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00085881-p1.