CAZyme Information: mRNA_M_BR32_EuGene_00084801-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00084801-p1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503		53209.95	8.3212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00009:1250560-1252068(-)

Full Sequence      

MFPIISIAIWATLLSTITSLTFPYENMQLDPAEALSFPSIAFGNATIPIPQQPSCKSYPG
EPTWPSEADWSRLNTTLNGRLLKPQPLGAVCAPSHPAYNSNRCNTLVRSLSGTRTLLDDP
LNVLTVYLEGDTCPISTSSRKPCTQGGFPVYVVNASTVAHVQAAVNFARNRNIRLIVKNT
GHDFGGRSAGAGALSIWTHHLKSATYLANYTADSSLYTGKAVHLGAGLEAWELSDIMVDH
RISLAAPGWATVGAVGGWMLGGGHGHVTSTLGLGADQPLSLNVVTADGRFVTADATHNAD
LFWALRGSGVGPAFGVVTSAVVRAYEPLSLVRVSLQWLTGPSYDPGNSPSPVVNRETFWR
GVSAYYRFGIAVGDAGGVDFGYIRNRGNGSFSFDTGLTFPNKSPREVFNLLAPLYANLQS
AGVNIANRLPAASSPYATRRGGTGASLGNARYSSRLWPRALWASDEGFAAAMAAVRSSVE
DGGYTFHGLLMAARPLGGDAADS

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	147	337	1.6e-35	0.3930131004366812

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.71e-07	149	294	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	9.39e-05	149	323	32	202	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	2.74e-46	53	421	498	860
QKD57322.1|CBM91|GH43_11	2.74e-46	53	421	498	860
UPK90596.1|AA7	1.09e-16	149	347	20	207
UQC87672.1|AA7	3.22e-15	149	331	70	241
QRC92907.1|AA7	4.23e-15	109	326	14	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	4.97e-66	31	423	2	379	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	2.96e-45	27	331	1	311	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	7.41e-15	149	337	37	220	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6FYE_A	9.54e-15	149	319	45	203	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYF_A	1.69e-14	149	319	45	203	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFM2|PATO_ASPCL	4.11e-69	24	420	6	373	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|A0A075TR33|PATO_PENEN	8.51e-67	54	424	27	376	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	2.56e-65	31	423	2	379	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	2.95e-65	27	424	1	375	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A0A1V6PBT1|CALF_PENDC	5.50e-62	51	482	23	443	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000761	0.999240	CS pos: 19-20. Pr: 0.9667

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00084801-p1.