CAZyme Information: mRNA_M_BR32_EuGene_00076701-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00076701-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	BR32_scaffold00008|CGC9	51816.22	5.6830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00008:547265-548689(-)

Full Sequence      

MTSKRDPYILILSHALTGHITPMLSVAGALLSRGWDVGFLGPTTHRAKIGSAGCEFFSLR
GKADIDDSLGTPAALGDGVDGHLPPHMRRILSDTRVQCYDTIPDQWDCIKEVLSALHARD
ADRQVLVICEAFVHGILPLKYGAALPPGIPEPKTICVSVTPPMIRTRLQPPFYSALPYDP
SPAGEARAAELWEEWGGGVGAEMESYLDVKVMRAGGTRRTKQLFLEGVNYTCHDSILQFG
LESFEYPRDDWPAGRFRFIGLPPPKGRRGVSEAEVRDVPWWEGFVANAELPGRDPTRSKV
VIVTQGTVEADATELIVPTLQAATRLAQEESLKLFLVVILGVRNASLPPSVCTVPPNVGV
VDYLRYGAVLPYADVWVHNGGYGAVSQGIAEGVPMIVAGEGQDKAENARRVAWSGIGLDL
KTARPTAEQVANSILEVLRDGSQYRDKVNDMQSQLKLYNFEETVDREVRKQIVI

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00076701-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	110	459	8.9e-24	0.7539267015706806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	7.79e-28	8	456	3	383	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	8.72e-24	9	442	3	377	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	3.92e-17	18	452	7	370	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	1.21e-04	353	450	343	441	ecdysteroid UDP-glucosyltransferase; Provisional
215305	PLN02562	3.42e-04	1	170	1	180	UDP-glycosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK94024.1|GT1	1.36e-62	1	468	20	458
CCD52882.1|GT1	1.09e-60	1	456	1	431
ATZ51905.1|GT1	1.09e-60	1	456	1	431
UQC81531.1|GT1	3.23e-59	3	454	117	540
AEO68393.1|GT1	3.00e-58	7	469	13	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J31_A	1.39e-09	355	440	278	363	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.40e-09	355	440	281	366	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
4AMB_A	9.86e-08	252	429	187	361	Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	9.86e-08	252	429	187	361	Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
3OTG_A	2.37e-07	250	442	185	378	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9L011|UGTB1_STABO	2.76e-47	7	458	6	417	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|E7CQW6|UGTA1_STABO	5.16e-47	3	459	4	422	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|J4VV61|GT1_BEAB2	1.51e-38	1	470	13	456	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|Q8KHE4|REBG_LENAE	4.65e-26	18	438	14	388	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|A0A0H2V630|IROB_ECOL6	3.66e-09	279	418	198	319	Enterobactin C-glucosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=iroB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00076701-p1.