CAZyme Information: mRNA_M_BR32_EuGene_00075911-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00075911-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40573.31	8.3517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00008:357186-358655(-)

Full Sequence      

MLFQVRPWRLVTALPWVLAVLVAGFFVTRLVGFLHIFGVLQPHSGIRITQGEIELAHNRG
RDPSDRPVVPRITHQIFHAWKHPGNDTLPGHWAHARESCRLHNPDWEHKIWYTENSREFL
RDNYPWFLPTYDGYKFPIQRIDVLRYFLLRHYGGIYLDLDNGCAASLDPLTYYPAFTTDG
GRGALSNNIMGGQSGHPYFHLLTENLAAWDWNWLLPYVIISYCSGQWYVTAMWERYHRLL
QLTPGSAGGSVAGLESLGRGWRPLHHVLMDMRDGADPWVYFTQVRGGTWSNWDSDIFPWI
GDHLPELAGAAAMASGLVAWFCLWCVRRRRTRDRGKGYLPLAVEEHALASRR

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00075911-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	92	171	4.5e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.43e-37	66	241	79	248	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.26e-22	89	170	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ58620.1|GT32	4.28e-281	1	352	1	352
QGA12364.1|GT32	3.14e-121	9	323	9	318
AEO56548.1|GT32	2.11e-110	16	330	12	326
UNI16793.1|GT32	5.11e-105	18	330	17	321
QBZ63730.1|GT32	9.49e-101	25	338	421	748

PDB Hits     

mRNA_M_BR32_EuGene_00075911-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	2.15e-52	62	345	75	343	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.22e-43	63	238	49	218	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.41e-42	69	239	57	221	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	3.29e-40	68	238	61	225	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.24e-35	63	335	58	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000002

TMHMM  Annotations     

Start	End
13	35
307	326