CAZyme Information: mRNA_M_BR32_EuGene_00072951-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00072951-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1237		137352.66	8.4072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00007:1255382-1259095(-)

Full Sequence      

MDRPHSRGAPPSYSNYDEDPDELRLGPAGNPAAVRLLPASSFDEEIPETRQYVSPLVPQP
AVVRKALLPPPLQITKTSSTDGPRKPPQSLSTPEHLSTLKQQEEARTPLASATTGRVKFS
LALASPDEKLLEDRGSGTSGSPSRKRTVKLQRKITQDTVAQGQTDASLPVIPIGPSPRMM
SRSLKKSSSEPGHHPASKTTHNSQAAPDIDSSFSDVTNHHSNKGQPSESNNTSSRPTHRA
YQPSVSSIHSRPSSISNIPSMPPPTESYVSYRETGSPTRPWTPSHVGRSSDEYRRAPPSS
VHYERADLNGSPRPGTPSSRYGGSPRRPLPPAPLFAGPGARSSAFADDATVSIPLSDVDD
PFGPGSADLGEARGHRGSYAAQSQVTLNEDDDEGSHLRESDIGYDEADAVDEKSAAHYGP
APAEGDQQRRGVREPQKSRKEVQLINGELVLETKIPTILYSFLPRRDADEFTHMRYTAVT
CDPDDFVERGYKLRQNIGVTARETELFVCVTMYNENEYDFTRTMHAVMKNISHFCRRSKS
RTWGENGWQKIVVCIVSDGREKIHPRTLDALAAMGVYQHGIAKNYVNQKAVQAHVYEYTT
QVSLDADLKFKGAEKGIVPCQMLFCLKERNQRKLNSHRWFFNAFGKALNPNVCILLDVGT
RPGGNSLYHLWKAFDTDSNVAGACGEIKAMKGRLGQNLLNPLVASQNFEYKMSNILDKPL
ESVFGYITVLPGALSAYRYHALQNDANGHGPLSQYFKGETLHGQHADVFTANMYLAEDRI
LCWELVAKRDERWVLKYVKGCTGETDVPGKSKPQILLQLCADQLTVFFSLSFSADTVPEF
ISQRRRWLNGAFFAAIYSLVHFRQLWATDHTVARKVLLHIEFVYQLLQVLFTFFSLANFY
LTFYFVAGGLADPLIDPFGNRIGLYIFTILRYTLILLICAQFILSLGNRPQGAKKPYFAS
MVIYGIVMVYTTFAAFYIVIRQLTDPKAKLEMGNNVFTNLIVSMASTIGLYFLMSFIYLD
PWHMFTSSIQYFMLLPSYLCTLQVYAFCNTHDVTWGTKGDNVMKTDLGGAVGKGSTVELE
MPSEQLDIDSGYDEALRNLRDRIEVPKSGDSEAQMQEDYYKSVRTYMVVSWMIANGILGM
AVSEIYSDRTISENYYLRFILWSVASLALFRALGSTTFAIINAVNIAVEGRVRLSLKLPT
WLGGSRGSKSAISSSVGSGTSIFTGLGEKITATLRRR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	512	674	2.6e-78	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	4.99e-112	512	674	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	8.29e-91	508	854	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.14e-32	441	511	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	2.62e-27	623	980	115	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.48e-15	510	742	3	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64571.1|GT2	0.0	1	1237	1	1211
AEQ16475.1|GT2	0.0	1	1237	1	996
UQC89829.1|GT2	0.0	4	1204	3	1197
UNI20420.1|GT2	0.0	235	1218	49	994
QLI70985.1|GT2	0.0	232	1218	46	989

PDB Hits     

mRNA_M_BR32_EuGene_00072951-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30589|CHS2_NEUCR	0.0	253	1198	120	1065	Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-2 PE=3 SV=4
sp|P30584|CHSA_EMENI	0.0	241	1213	31	982	Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsA PE=3 SV=2
sp|P30600|CHS1_EXODE	0.0	253	1193	38	932	Chitin synthase 1 OS=Exophiala dermatitidis OX=5970 GN=CHS1 PE=3 SV=2
sp|Q92444|CHS2_PARBR	0.0	276	1231	82	1022	Chitin synthase 2 OS=Paracoccidioides brasiliensis OX=121759 GN=CHS2 PE=3 SV=2
sp|P87073|CHS1_PHYB8	4.13e-287	418	1180	89	835	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000001

TMHMM  Annotations     

Start	End
887	909
922	944
957	979
1000	1019
1029	1048
1125	1147
1162	1184