CAZyme Information: mRNA_M_BR32_EuGene_00072791-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00072791-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		64443.04	5.9975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00007:1208305-1210218(+)

Full Sequence      

MGPTKFLFLLPLLAHLAEANAGDSAQVPLHGFEHAACPDYASYSKYKHPPFSDGPLKLPY
QRPDPRCRTFNNDAIEKVIKDVTSRMKDPDMARLFENAFPSTTDTTVKFHTDGKTKHRSK
PHDEDDDFFGFGTDSKGAWEGPQSFIITGDIIAEWLRDSTNQLAPYQPLAQKNQAVRTLI
LGAINTQAEYIIQSPYCNAFQPPPIANLPISHNGQDDTVHPNYDPNFVFECKYELDSLAH
FLAIGNDFFEETGSTEFVNSRWLLALDTLLIVLEQQAMPTFNSKTGSFRLNQYTFQRRTT
LGTETLNLQGVGNPLGNGTGLVRSAFRPSDDASILGFFIPANAMMAVELGRAAKALKAAD
MADDTLTATVERWSKTITEAVWEHGVVKHKTHGDVFAYEVDGYGSAILMDDANYPSLLAL
PVMGFVSKEDKIYQNTRKMLLSKQSNPYYLEGRDFRGIGGMSVYNKARKWGNCVSACACV
LTKLTRLTGPHIGLQNAWPMSLLMQAQTTDDDEEIQGCLQLVLKSALLGLVHESVDVNQI
TSYTRSWFAWANGVFAATILDLAKRKPYLIFKDSEPYVI

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00072791-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	88	465	3.5e-127	0.8308457711442786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	88	560	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	5.30e-153	67	569	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64587.1|GH125	0.0	1	579	1	550
CDP30915.1|GH125	1.61e-279	9	579	10	555
CAP71519.1|GH125	1.61e-279	9	579	10	555
VBB84114.1|GH125	3.24e-279	9	579	10	555
UNI20401.1|GH125	1.10e-267	26	579	32	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	2.82e-76	62	562	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	7.36e-76	62	562	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.16e-74	62	562	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
6RQK_A	1.36e-70	73	561	10	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	2.16e-70	73	561	10	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	8.78e-172	36	575	26	509	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999756	CS pos: 19-20. Pr: 0.9905

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00072791-p1.