CAZyme Information: mRNA_M_BR32_EuGene_00071781-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00071781-p1
• CAZy Family: GH15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		93503.82	5.1227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00007:928785-931409(-)

Full Sequence      

MTFKRQLKDCLVTSVLLANLFGTAVAKDESILHTEVAHLNNDTLLWGPYKPNLYFGVRSR
TPKSLNMGLLWAKLDNYNEVQHHIRYTCEQNEGMAGYGWDEYDTRRGGVQTIHDAQNQID
ISTSFVKIPGGANGGSWAARIKGELRPDAAKDAKTGVWLYITQEGLGSLETVGSGDDNGF
PDDFSLKGNSQTLGDYKISVTKGTGEHPDGHEELSKERDLKKTSVQSISIPEEALWQAKP
VIFRQLKEHIESIQSRFGEEDTPQPWDVYALPHKPGGGNAHIVQKIFEGSFEFDVIFNSA
SAGKELGSDDVTREIRSTTEAFGERFSDVFNLKAPFTADKYKKFGRSMFSNLIGGIGYFY
GDSVVDRSYAPEYEEENEGFWEEAAQARARKQEGMEEPSELFTSIPSRPFFPRGFLWDEG
FHLIPIADWDMDLTLEIVKSWFNLMDDDGWIAREQILGAEARSKVPAEFQVQYPHYANPP
TLFFIIDTFVERLRKLNGTMPAHKEQLSQGASVSNSHIENPIVGTEFLRNLYPLLRKQYD
WFRSTQKGDIKSYDREAFSKREAYRWRGRTVQHVLTSGLDDYPRPQPPHPGELHVDLMSW
MGLMTKSLLNIADALGMQEEVAEFQKNLEAIERNLDDLHWSEKEGCYCDATIDAFEEHQL
VCHKGYISLFPFITGLLKHDSSKLGRTLDLIGDEEELFSPHGIRSLSLKNEFYGTAENYW
RSPVWININYLTLVQLKNVATQDGPYKQKAKDLYTKLRINLIDTVYKSWEETGFAWEQYN
PETGKGQRTQHFTGWTSLVVKIMTMDDLGGGAAPSKGHEKDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	592	803	2.7e-30	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	306	805	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.38e-104	44	263	1	220	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.02e-07	525	800	358	599	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	1.29e-04	595	797	578	773	alpha-glucosidase; Provisional
395961	Trehalase	0.005	595	809	305	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64685.1|GH63	0.0	1	823	1	823
CAC18158.1|GH63	0.0	5	823	10	834
AEO63368.1|GH63	0.0	5	823	5	831
AEO56870.1|GH63	0.0	12	823	16	838
UNI18650.1|GH63	0.0	22	823	17	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.42e-178	35	803	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.51e-129	44	803	37	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.84e-229	35	804	33	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.41e-177	11	803	14	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	5.17e-130	44	803	92	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	5.89e-128	46	803	94	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.14e-123	44	806	94	836	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001772	0.998202	CS pos: 26-27. Pr: 0.9660

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00071781-p1.