CAZyme Information: mRNA_M_BR32_EuGene_00070861-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00070861-p1
• CAZy Family: GH13|GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	BR32_scaffold00007|CGC5	49710.38	4.6252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00007:660574-661920(+)

Full Sequence      

MPSISFLALALGLFAQKTLGGVTVRKTGTAPTGYEVDFTLVNETASHVIVAGGLFPFTDQ
WHTGWQYSGGWSPKEYQRGDFILPQTAGGLEDADWPYVMESDGQGSWHLTVPMPSGTYNY
AFLVDCEVPSNCTFGSGKWVIDPENPPFVNVPGDQTASSFQVPFDAEFQGTPSGGSDLDF
DYALPRAEASEHGTVATVNYTSPGSVWPAPDVHDCTVYTPPGYDSNSDREYPIMYLSHGA
GGNGDDWQNLARMSNIMDNLIADGFIEPTVVVTPSFYNIAPEYNFTYGLAPRAPDAPVVR
ENYFAHLFPFIEANYRVSKSPSRRAFAGLSLGGRLTYEMYINATDYFDYFGIFSGAQGMV
DASHLAPRAAELRRKGVFNSYGLYDFTFDMDRSLEVAMNANRIRYVSRIQPWGGHYWPTW
LDCLYHFGRRALWKPLPFDARTGRSVKD

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00070861-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	214	426	6e-37	0.920704845814978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225256	Fes	1.84e-11	217	420	86	284	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
395613	Esterase	4.15e-07	217	420	12	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
199889	E_set_AMPKbeta_like_N	2.93e-06	94	150	22	69	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
225375	YbbA	5.74e-06	217	356	27	171	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
226040	LpqC	0.001	218	369	52	190	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW66742.1|CE0	1.48e-50	16	443	41	461
UPK72241.1|CBM48|CE1	3.55e-31	97	427	334	647
UQB68901.1|CBM48|CE1	2.06e-30	97	432	331	640
UPQ80649.1|CE0	1.01e-29	74	427	53	384
QDV29582.1|CE0	1.26e-28	186	435	40	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZO_A	3.07e-27	97	429	46	340	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	3.12e-27	97	429	46	340	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	1.28e-26	193	442	30	268	Chain A, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
6RZN_A	2.03e-26	35	427	32	380	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JT2_A	3.34e-26	193	442	30	268	Chain A, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10478|XYNZ_ACET2	3.45e-24	193	442	49	287	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
sp|D5EXZ4|AXFA_PRER2	3.20e-20	90	427	351	664	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
sp|D5EY13|XYFA_PRER2	1.43e-16	98	424	428	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
sp|P51584|XYNY_ACETH	6.52e-13	217	355	845	979	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
sp|P31471|YIEL_ECOLI	6.42e-12	89	355	66	304	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999734	CS pos: 20-21. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00070861-p1.