CAZyme Information: mRNA_M_BR32_EuGene_00067851-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00067851-p1
• CAZy Family: GH131
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710	BR32_scaffold00006|CGC4	74013.73	4.9447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00006:1823943-1826168(+)

Full Sequence      

MSPSLVTLATAVLACASTAAAAKAYQIEETYDTSNVNSKWDFFQSKFDTGNVLDIDPTEG
FVNYRSYNDAKSLGVLSEESGSIMMKPNFPAGITANGKGPDSVRLESKARYQQGLFIADF
SRFPKPVCGSWPAFWMFGNSWPEEGELDIYEGWNVQPVNGIALHTDHAAKVGSCHLDPQD
VNADVHTTNCDNFFTDIPRQWEGTACLVKERNGLWGNPTGGVYAIEWSSQNVSVWSWAHD
KTPADVRDGKPSPRTWGRPHFFIGDSKCDIDRVLKNQKMVLNLDFCGVTAGNEGIWGEEC
KAKTGAATCAQYVAGNPSAFSDVAFGLRSIKVYQNKEVEEPKPTTTAQSTTTTTTPSSTS
SPSSTNTTTSPSTTATTTASSTEASTSASSTLTTTTPASTSPSATATPSSTSDCEEDEPT
GTPTPPTTKASTTAAGTTTTKEPEQSVTSTLTTTKTYTVTSCAPTVTSCSLGQVTSEVIT
TTTICPVTTTATGTATSTAAGSSTITPIGTLTPTGSATTKEPEQSVTSTLTTTKTYTITS
CAPTVTNCPIGQVTSEVVTTTTVCPVTTTDTGSTSTKTLIGTLTTPTGAATTKAPEQSVT
STLTTTKTYTITSCAPAVTNCPIGQVTSEVITTTTVCPPEPTSTLKTTTIHSTLSLTSTI
RIPRPSSSSVSSKSTPPFPSSSAFGGSNSTLPGSTKTATPTLTRGTATGT

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00067851-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	79	313	5.9e-61	0.9606986899563319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	1.60e-120	25	334	2	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185691	GH16_Strep_laminarinase_like	7.20e-05	129	175	106	158	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	7.38e-05	122	263	87	204	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57443.1|GH16_1	0.0	1	710	1	716
ATY64187.1|GH16_1	2.65e-98	25	334	23	344
AEO55983.1|GH16_1	6.18e-97	1	351	1	331
ACM90498.1|GH16_1	6.37e-91	1	334	1	331
UQC85230.1|GH16_1	1.27e-87	1	349	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WDU_A	2.66e-46	25	333	2	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	2.73e-46	25	333	3	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	1.77e-45	25	333	1	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	1.87e-45	25	333	3	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']
5JVV_A	7.33e-42	54	333	23	297	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AJR9|EGLX_ARTBC	6.92e-58	25	334	20	315	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	1.19e-54	23	351	31	343	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	3.42e-53	25	334	32	327	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	3.42e-53	25	334	32	327	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1
sp|Q2UIE6|EGLX_ASPOR	3.82e-52	25	352	31	350	Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000083 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005180	0.994797	CS pos: 21-22. Pr: 0.9283

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00067851-p1.