CAZyme Information: mRNA_M_BR32_EuGene_00067671-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00067671-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31335.22	8.0464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00006:1774560-1775526(-)

Full Sequence      

MRFSSIFTVLATAAMASAAQLQQVTNWGDNPTNIQMFIYVPDRVAANPAVIVALHPCGGN
ARQWFSGTRLPSYADQNGFILIYAGTPNQSNCWDVQNPASLTHGQGGDAKGIVAMVNYTL
NRYNGNKDKVYVMGSSSGAMMTNVMAGSYPDVFEAGAAYSGTAHACFAGAAGATPFSPNQ
TCAQGLTHTPQQWGDFVRNSYPGYTGRRPRMQIWHGNADFLVRPACAHEALKQWSNVLDV
TVSRNVTGVPSAQYTQVIYGDGSKLQGFFGNGVGHTAPVNEDLMLRFFGLIA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00067671-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	32	232	4.9e-24	0.8193832599118943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.13e-41	36	248	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.00e-20	30	278	43	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.31e-18	38	233	5	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	2.91e-05	71	161	7	97	Prolyl oligopeptidase family.
226584	COG4099	0.007	120	161	261	302	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57428.1|CE1	1.49e-219	1	292	1	292
VBB78227.1|CE1	7.64e-165	1	292	1	292
AFU88756.1|CE1	1.03e-162	11	291	11	291
CDP27505.1|CE1	1.32e-161	1	292	1	314
CAP70910.1|CE1	1.32e-161	1	292	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	5.74e-77	18	289	1	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	4.56e-157	12	291	12	291	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	5.97e-148	7	291	9	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	8.76e-98	18	290	18	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	3.18e-94	18	290	18	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|A1CSZ8|AXE1_ASPCL	6.67e-83	4	289	19	305	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000320	0.999658	CS pos: 18-19. Pr: 0.9512

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00067671-p1.