CAZyme Information: mRNA_M_BR32_EuGene_00065191-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00065191-p1
• CAZy Family: GH128
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		46599.56	7.6152

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00006:991825-993256(+)

Full Sequence      

MVQFMKSVRVAAMAISAVPKDMKISESASVQAVVKTIAADTMSYYKGSATNYVDLEAPYW
WWQSGALFGAMSDYSHYTGDKSYDQTIATALLAQTGPKYDFMSPAHEGQMGNDDLGFWGF
AVMSAAERNLPQPESSVPSWLKMGENIHASLASRWDTTTCGGGLLWQIFASNPNGLNYKN
SVSNGAFFQLSARLARATGNQTYMDWANKIFDWSTGVGFVDQNFHVVDGADKRDDCKKVN
PVSFTYTNGIYMYGAALLANMTSDRKWIDRTQKFVEASKAYFGPTATTPDILYEPACESG
GTCNVDMKSHKGQLARFMWASTLMQPAIRPAVETLLLPSAQAAASTCTGGANGSQCSHRW
WTGAFDNDTGLGQEMCALETIQGILAGSAAPPLRGNDIKDVRVPKQGASASAPKRLVREE
RRLAARRA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00065191-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	23	388	3.3e-87	0.946927374301676

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.54e-138	29	378	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.23e-08	161	278	133	244	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57188.1|GH76	1.34e-317	1	428	1	428
AAX07733.1|GH76	3.97e-307	1	428	1	421
AEO60662.1|GH76	1.02e-182	19	402	22	405
AEO70787.1|GH76	6.07e-182	2	415	4	416
VBB73902.1|GH76	1.14e-173	2	402	4	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.09e-80	35	392	41	410	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
4C1S_A	4.23e-07	155	284	145	275	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	1.98e-94	21	392	20	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	2.26e-91	21	384	23	386	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	4.30e-89	24	385	24	384	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.48e-88	29	381	31	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	6.18e-85	37	392	36	395	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998364	0.001657

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00065191-p1.