CAZyme Information: mRNA_M_BR32_EuGene_00063071-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00063071-p1
• CAZy Family: GH125
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835	BR32_scaffold00006|CGC2	91022.05	5.6004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00006:392241-394945(+)

Full Sequence      

MAEIDVEEVLKKLTVAEKVDLLSGIDFWHTKPLHHHGIPSLRLSDGPNGVRGTRFFNGVR
AACFPCGTALGATFNQELLEEAGRKMGEDAKTKSAHAILGPTINMQRGPLGGRGFESLSE
DPVLAGLGAAAIVRGIQSTGVQATIKHFVCNDQEHRRNAVQSILTERALRETYALPFQIA
VRDSNPASFMTGYNGVNGTYCSENTKLLDDMLRKEWGWDGMVMSDWYGTYTTTEAANAGL
DLEMPGPPRFRGDLLKFCVDTDKVRRHVLDERARAMLKFINKCAAAGVEENGPETTDQDT
PETAALLRRIGTDSQVLLKNDKNVLPLSKDKKTVVIGPNAKVATYHGGGSASLLAFYAVT
PFDGIKAKLGKEPEFAVGAYSHKMLPVLGGACQTAKGQPGMTMRVFNEPPTDADRACTDE
FTFTKTEHLFVDYYNPKLKSKTWYADYEGYLVAEEDCTWEFGVVVSGSGKLFINGDLVVD
NASKQKRGDAFFGTGTVEEKGTYKLTKGEKYHIKLQYGSAPTSTLPIEGMALGEGALRIG
GCKIIDAKEEIAKAAALAKDADQVIICGGLNADWETEGHDRDDMRLPAPMDDLIAAVAAA
NKNTVVVMQSGTPVEMPWHDDVAAIVQSWYGGNETGNAIADVLFGDVNPSGKLPLSFPKR
LQDNPAFLNFRAEGARTLYGEDVYIGYRFYEATDRAVLYPFGHGLSYTTFAFGDLKVGKD
DKLVTVEAAVSNTGSVKGAEVVQVYVAPKQKSSVNRPVKELKGFAKVELDAGEKKTVKVD
IETKYAASFWDEHRNQWCVEQGEYEVIVSDSSAVLDSKALKGSFKISETFWWSGV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	245	6.2e-62	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.19e-70	64	824	120	762	beta-glucosidase BglX.
224389	BglX	1.15e-62	37	372	59	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.07e-57	316	707	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.52e-39	13	782	60	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.75e-34	37	277	65	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56956.1|GH3	0.0	1	835	10	844
UQC84651.1|GH3	0.0	1	835	1	833
CEF74963.1|GH3	0.0	1	835	1	832
CZS78241.1|GH3	0.0	1	835	1	832
QKD55051.1|GH3	0.0	1	835	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.00e-274	1	835	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.87e-266	2	835	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.92e-135	4	829	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.05e-122	13	812	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.44e-104	6	828	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	0.0	1	835	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	1	835	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	0.0	1	835	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	0.0	1	835	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	835	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999959	0.000077

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00063071-p1.