CAZyme Information: mRNA_M_BR32_EuGene_00061211-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00061211-p1
• CAZy Family: GH11
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		37193.99	8.7684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00005:2319850-2320860(+)

Full Sequence      

MILAFHNRLTAKALAALSFLTICFIILNFHRPSGWKAGPTFATPRVKPAPPPLAQETTTT
AASSSGPTAVAALPQKLWYKLGPAGLKDDLKPHVDSCVSKNPGFKVEFLTDESGDAFVKR
HFAALRPDMVANFLAIRIPIIKADLLRYLILYEFGGVWNDLDVSCEAPISEWVPKQYKDQ
ANIVVGLEFDVDQWVRQFASWTIMAKPKSPHMMMAVQDCLEGLVAKAKERKVGGIQDLRL
DMVDDIVDVSGPRRLTRGILKSLSNTLNETVGDGEIANVKEPRLLGDVLVLPDYAFADTM
NQQHGDKKTGRKLVVHHYAGSWKNEDGGERHQRAKV

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00061211-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	175	6.3e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	7.48e-14	94	177	8	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	8.02e-13	71	207	80	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ66259.1|GT32	5.14e-225	1	330	1	330
QBZ63395.1|GT32	3.91e-123	6	329	6	327
CAE7026497.1|GT32	1.71e-90	71	330	50	312
CBY00800.1|GT32	2.38e-89	73	328	59	317
CAE7002672.1|GT32	4.76e-88	73	329	72	332

PDB Hits     

mRNA_M_BR32_EuGene_00061211-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.70e-20	100	332	130	385	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.98e-20	101	325	169	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.40e-19	99	324	156	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	9.25e-10	71	210	94	273	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.02e-06	97	166	86	151	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000001

TMHMM  Annotations     

Start	End
13	35