CAZyme Information: mRNA_M_BR32_EuGene_00059441-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00059441-p1
• CAZy Family: GH105
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		64624.61	4.8051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00005:1874216-1876068(+)

Full Sequence      

MAETNKTYDFIVVGAGPAGCTIAARLADSNAQPSVLLLEAGADDGTDMTKRMSSNRFMQR
YDESQTWGYESEPTESLGDRGFPLDRGKGLGGSTAVNFSCWTRGPKDDMDEMARLTGDSS
WEWERTVERFKSIESFHGDLEEMPKGAGNYIQSTQNTSYGTDGPIHISFPQKWDAEVTDM
IDIWKENGYALNKDLSDGSMLGLSVTPSTEYRGVRVTAADVLFPRPSNLNIMVEAPVHQV
LFDEQKRATGVQLIDGRQLHVSKEVIISAGALDSPKILMHSGIGPEDQLTKFDIPVLHDL
PGVGANYADHYHASFVWRRKEHTSIRPDFFSDPKRIEKAQRDWELYRTGDYVTLGTQLST
GFFKSEATLKSAEFQALPDKEKQRMRKPTIPTYEIVWNATAPMYYETTKKLPALSVALLI
LLNSQGRGAFTLQSADPALPLRFAPDFLRAPYDRRAAVEATRELLKVASSEAFQRDNVQA
VFAPASDSDEDILAFWRDTTSSTWHMCGTIMMATKADGEGDGGDPGCVDTGFCVHGVEGL
RVADMSIMPILPSAHTQSTAYQIGMIAAEKLIEEYDLSVARSRL

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00059441-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	573	8.2e-144	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.77e-80	1	580	1	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.12e-80	4	570	2	526	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.23e-28	427	565	4	141	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.84e-25	7	574	55	579	Protein HOTHEAD
366272	GMC_oxred_N	8.30e-23	76	311	13	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ66107.1|AA3_2	0.0	1	584	1	584
UPK95388.1|AA3_2	6.31e-203	1	584	1	577
UPL00845.1|AA3_2	1.12e-158	5	578	3	565
CEI63764.1|AA3_2	2.24e-158	6	578	4	565
QMW33321.1|AA3_2	4.92e-157	5	578	2	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.79e-46	2	575	1	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.83e-46	2	575	1	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	5.26e-46	2	575	1	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
6O9N_A	4.51e-45	1	575	29	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4H7U_A	4.91e-45	8	576	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6D6D9|BETA_PECAS	1.20e-53	8	583	3	541	Oxygen-dependent choline dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=betA PE=3 SV=1
sp|A7MFA8|BETA_CROS8	4.41e-53	8	571	3	531	Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=betA PE=3 SV=1
sp|B4EX94|BETA_PROMH	7.85e-53	8	571	3	531	Oxygen-dependent choline dehydrogenase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=betA PE=3 SV=1
sp|B9JBA2|BETA_AGRRK	1.86e-52	9	572	4	526	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1
sp|B3PTE0|BETA_RHIE6	3.43e-51	9	578	4	532	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000007

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00059441-p1.