CAZyme Information: mRNA_M_BR32_EuGene_00052641-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00052641-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		52998.54	9.6692

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00005:39230-40698(+)

Full Sequence      

MGQYAAPSWVNRAARDYFGGGGRHLLLLLIPVTLFFFGVNFLPKYTYNDPTSAFFSPIHA
YGRKYSNVRLAESKEFIKSYNATGAPDFRREFPVTPANPPPFLCATATTVVRPSGAIYFP
ETIGSLLSGLSQKERDQIYLMPLFGHTNQSEHPVFGQPWVGRVTDRILSYADSEMDSKDR
AHVAELEAEYKKTGIPDREKMMFDYSYAIKACAATKAPYILYFEDDVAFADGWFHRTKRA
LFEAEQKTKNDKRGFFYLRLFYISKKEWPEQFKLSYFRTSAVLLVIFLLIWRFSRPTFAQ
SLRQKSANKGGLIAATVLTTYVVYTWLYFSAGVELAHGPERGVFPMNSCCAQATIFPNKM
VEPLTDWYRERRIGFVDELAEKVANEKPDVFGPRFYVKPALVQHVGSKSSKGDNWGSDKP
GQMAEAERVWNFGFEAWSQKRLAEDHKNAVAASAGLQRRGAVIGRVA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00052641-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT109	24	452	5.7e-113	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409190	PGAP4-like_fungal	4.42e-119	32	413	9	375	uncharacterized fungal proteins similar to Post-GPI attachment to proteins factor 4. This subfamily contains uncharacterized fungal proteins with similarity to animal post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. Proteins from this subfamily contain the putative catalytic site of PGAP4 and may have similar activities.
409189	PGAP4-like	4.50e-27	33	410	5	361	Post-GPI attachment to proteins factor 4 and similar proteins. This family includes post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. This family also includes uncharacterized fungal proteins with similarity to PGAP4.
225843	COG3306	0.007	210	280	80	146	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65506.1|GT109	0.0	1	467	1	467
QMW30601.1|GT109	1.99e-67	46	446	40	425
QMW42654.1|GT109	5.50e-67	46	447	40	426
QRD89485.1|GT109	6.51e-67	46	446	87	472
CAP93941.1|GT109	1.60e-66	49	446	37	426

PDB Hits     

mRNA_M_BR32_EuGene_00052641-p1 has no PDB hit.

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00052641-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000009

TMHMM  Annotations     

Start	End
20	42
274	291
311	333