CAZyme Information: mRNA_M_BR32_EuGene_00051271-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00051271-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		77228.14	5.8151

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00004:2085409-2087739(-)

Full Sequence      

MGFRRDTLMRLLLASVIIPLSLALMLDTRVYRRQDSDENSWQKFVRASQTTVIKPKDVVS
RQTQGNVSHPNGLVKGDAPTVLTRTQASGKASIIVDFGQNTVGLLSIRFAGASAVTSNRN
TLPGLKLAFSETLEFLGDRSDFTRSDHASGDAKLTNGTDQIAVKQQPYEWLAQSGCEHGR
QVCGDGLHGFRYVKITLEALDSDSPYTTSYGTVSISSIELHLSAFHGTPDTFTGNFECSD
KSITQWWYDAVYTNDLCIDTFRLNDTEPRDAGSPTLVGKLVLHDGAKRDRDPYVGDLAVA
ALTAYISHDVASSAKNVLADLAAHQRNDGWIPPASICDYAVYTGDLDYLRSVWPSLVKVL
DNFYPSVTNSETNLVERTGYRDYAFIPREGPVTYYNALYVRALKYAADLAEQIGQDQYAP
RWRDRATVTGAALLKRNWDSSVGAFFDGGRCGSSQLCPSHSQDGNSLAILSGIANTSTDS
GNSRSSVAESILSYLDSSLKRPWGNAFYDNDQVSDGYSQRVYAFISYFEIAARLEVPSTQ
ESAFDEIRRLYGTMSAGDPGVTFWEGIGPGGSPYQGGFTSMSHGWSTGIVPLMTNYVLGI
TAKKVGFEQWEVKPVVAGELTWARGAMPTPRGAIRVSWTAGQNGAALELDVDAPEGTSGV
IGVPVSSKEARVSMGGAVIYDGAAGTAQSGATFKDGRVSVNVGAGKHQLSVAKAA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00051271-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	90	661	1.3e-77	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	8.04e-15	233	473	3	237	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	7.37e-11	599	677	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
283786	GDE_C	4.28e-06	335	447	92	220	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
273702	oligosac_amyl	1.74e-04	343	448	369	468	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
225942	GDB1	0.001	314	426	305	450	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59627.1|GH78	0.0	1	715	1	733
UKZ52996.1|GH78	4.55e-257	22	711	13	695
UKZ97108.1|GH78	3.09e-256	12	711	1	710
UKZ64081.1|GH78	2.51e-255	12	711	1	710
QYT03284.1|GH78	8.48e-254	12	711	1	711

PDB Hits     

mRNA_M_BR32_EuGene_00051271-p1 has no PDB hit.

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00051271-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.711408	0.288584

TMHMM  Annotations     

Start	End
7	26