CAZyme Information: mRNA_M_BR32_EuGene_00048381-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00048381-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	BR32_scaffold00004|CGC8	40845.20	6.5016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00004:1224439-1225591(-)

Full Sequence      

MAFWKEMAIGVADGNTMSTLLDQATQTISRPRYRKGLLTVLALTVLSTVWLYGTAIVQRT
GQLVKHVNHSFRGPRYHSTWDDAYGVKSHADHLIPPNIWQIMLPKAWGDDTPVNTDTLKE
TATWLAMNRDYRYTLVGEDGGKGFVKHHFGDNETIVSLFNSLPNVGMKSDLLRYMLLYVE
GGVYTDTDTVALKPIDQWVPRTFRNQTKLVVGIEFDQLDGGRWADIPHTIQFCQWTIAAA
PRHPVFQMMISRIIESWEYLKREHNPDGQNPTWNPSNFEVLNSTGPAAWTDVVWEYLQTT
DDSLTDLRNLSSLGPPRLFRDALVLPIDGFGMGQRHSGSTNDGSVPEGALVRHLFGGSWR
GD

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00048381-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	121	200	5.3e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.05e-21	74	291	64	281	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.64e-14	123	202	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.002	169	258	114	193	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59334.1|GT32	5.44e-280	1	362	1	362
QBZ58514.1|GT32	1.31e-153	54	360	64	368
QKX53490.1|GT32	2.75e-120	29	362	19	361
QYT06191.1|GT32	7.71e-116	21	362	13	352
UKZ83874.1|GT32	4.40e-115	21	362	13	352

PDB Hits     

mRNA_M_BR32_EuGene_00048381-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.12e-43	84	362	134	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.87e-36	95	362	100	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.35e-26	95	360	131	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	6.91e-25	94	362	96	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5UQW4|YL373_MIMIV	5.16e-06	125	321	29	191	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000034

TMHMM  Annotations     

Start	End
36	58