CAZyme Information: mRNA_M_BR32_EuGene_00045181-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00045181-p1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	BR32_scaffold00004|CGC4	24949.13	5.0985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00004:277534-278205(-)

Full Sequence      

MGRWSHLDTDEERLPEGMVRIGYDADDETYTFRDERDGSIWESAPGCRYGRLRQISEGTR
SNVGQQRPRASTMPMAPPPPYSDEAPNASFTDILRAHAADMARAQPPAAPQRSSTQYLEP
QRPSWRHELMPLLHFFTLIGLFLVGVFWLLGGFDSILSNDGALQKVVCGEKATPYVIQRG
DTCWAISQRIGVQVDDLLDANQRLDCDHLALGKTICLPEGKFA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00045181-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197609	LysM	6.66e-13	175	217	2	44	Lysin motif.
396179	LysM	2.56e-12	175	218	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
212030	LysM	3.43e-10	175	217	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
224306	LysM	0.001	173	223	67	116	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59024.1|CBM50	3.20e-166	1	223	1	223
QUF60502.1|CBM50	8.33e-48	1	219	1	172
QUF60505.1|CBM50	8.33e-48	1	219	1	172
QUF60504.1|CBM50	8.33e-48	1	219	1	172
QUF60506.1|CBM50	1.67e-47	1	219	1	172

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PXV_A	9.60e-08	173	219	3	49	Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_A Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00045181-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000000

TMHMM  Annotations     

Start	End
131	153