CAZyme Information: mRNA_M_BR32_EuGene_00042341-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00042341-p1
• CAZy Family: CE16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206		22874.51	6.4914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:2909704-2910703(-)

Full Sequence      

MLTSKALILALAAHLSLAADLNKWSWANQAGPYQYYIHGSGSVDKYISLSPGYKNPNETA
SARGARFALDGAVFWIGQNMRRTELISQITAGIHFTEMSYGWISGEQGTSNKNLQWMVGQ
RSLWKTEWKPDVWHNVAYEIDFGARTVGFWHSEGGTPLERKFAPANLPPPTEPTDTWASS
SFHDSNTNEDFYFSGVISSPTPSPPL

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	93	196	2e-31	0.45098039215686275

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	2.40e-31	22	196	17	243	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61375.1|GH131	6.76e-132	18	206	705	893
AEO69159.1|GH131	7.73e-76	15	196	28	245
UQC77645.1|GH131	1.72e-72	18	196	29	243
EAA27532.1|GH131	2.36e-72	18	196	33	247
VBB86580.1|GH131	1.85e-68	18	197	33	250

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	2.29e-66	18	196	15	229	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	2.32e-36	19	196	16	220	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00042341-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999754	CS pos: 18-19. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00042341-p1.