CAZyme Information: mRNA_M_BR32_EuGene_00040301-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00040301-p1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	BR32_scaffold00003|CGC5	63708.14	6.0378

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:2316132-2318177(-)

Full Sequence      

MGSLDQDQVYDFIICGQVLTKQGSGTSGCVIAGRLAESPNVSILLIEAGPDSKDLENVHM
VGGARQLFDLETDWNVTSQPNPGADDRTVKLTRGKFLGGCSGCNATLCIRGSRQDFDDWG
VEGWSGDEVFAYMRKAERFHGRDWFRACEAEHGTDGLLDVEPYDLAPISDLLLESFVDKG
LPLDHDLFTHGRNPHGCGHAPRSVHNGVRSTAARFVADKARARSGVDIMTETLVDKVVVE
RVGGELRATGVRLVKADGSVVHVKAGKEVIVSGGSYCSPNILNRSGIGAKEELDKFGIET
LVDLAGVGKNLMDHLIAFIIYETEHQGLTVDKDLFHDDGLARSYALWKDHKAGVLAGFPF
GCVAFARLDSRLSDSAVWNAAPRQPGRDPMGLTPRQPNVELMTIQCYGGPKSFTDFPVGG
SHTFCLVLELFSPRSRGSVALRSADPRDVPLVDTNYLADPLDVEVMAEACRFANEIVVDG
KGTRDVVKGSWPRELTHHRYTTREDWIPFVKKNATTCYHPAGTCAMGKTDDPKTVVDAKL
RVKGVNGLRVADCSIMPTLNGGHTQMPAYAIGEKAADLIKEAWDLK

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00040301-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	581	3.2e-156	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.77e-101	7	580	3	532	choline dehydrogenase; Validated
225186	BetA	1.81e-100	5	582	3	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	2.28e-51	23	579	7	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.33e-41	433	575	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.08e-32	84	316	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61175.1|AA3_2	0.0	23	586	510	1072
UPK91457.1|AA3_2	4.12e-286	7	583	4	573
QGI66019.1|AA3_2	4.43e-283	7	585	8	579
CCT70164.1|AA3_2	4.43e-283	7	585	8	579
QGI96901.1|AA3_2	4.43e-283	7	585	8	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.47e-70	10	580	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.45e-70	10	580	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.81e-70	10	580	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	4.52e-65	10	584	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6YRU_AAA	2.03e-61	8	579	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	1.29e-74	4	583	35	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q8UH55|BETA_AGRFC	6.54e-71	23	579	9	525	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|P18172|DHGL_DROPS	1.78e-70	5	586	60	611	Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Gld PE=3 SV=4
sp|Q47944|SDH_GLUOY	3.19e-70	10	580	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|P18173|DHGL_DROME	3.51e-69	5	586	60	611	Glucose dehydrogenase [FAD, quinone] OS=Drosophila melanogaster OX=7227 GN=Gld PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00040301-p1.