CAZyme Information: mRNA_M_BR32_EuGene_00037441-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00037441-p1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		36710.55	7.2909

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:1494734-1495756(-)

Full Sequence      

MSYNSGYGNQQGGANSSYYNSGGPQNQGQNPYGGPPPLNGQQQGGPPPSYNHGPGFNQGG
NHGPPHHGGPGGVGQDGERGILGAMGGGAAGGFAGHKMGHGILGAIGGAVAGHFAEEKVK
DWRDDKKEEEERRKREEEDRRRREDDDKRRREEDDRRRHDNNNNNNRGCSPPRGNYAGNF
SGSSRDICLDGARLRAECRRGDGGYSTSVIDLNRYLSNDNGHFRWVSGGGGGGGTATVTV
QQGDTLRDIGRRFDCDFHEIARRNNIQNEDLIYPGQVLQVPTKGGSGGGAGNFWDSARDV
RLVDGGKVLEAELRYSGGWNRSRIYLDEHIGNRNGELIHC

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00037441-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400991	CVNH	5.41e-23	180	337	1	100	CVNH domain. CyanoVirin-N Homology domains are found in the sugar-binding antiviral protein cyanovirin-N (CVN) as well as filamentous ascomycetes and in the fern Ceratopteris richardii.
212030	LysM	2.36e-11	237	280	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	8.28e-11	238	281	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	1.70e-10	237	280	1	44	Lysin motif.
400991	CVNH	5.26e-06	178	224	49	101	CVNH domain. CyanoVirin-N Homology domains are found in the sugar-binding antiviral protein cyanovirin-N (CVN) as well as filamentous ascomycetes and in the fern Ceratopteris richardii.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60874.1|CBM50	8.54e-167	1	340	1	339
UPK95422.1|CBM50	2.22e-54	173	337	331	496
UQC79577.1|CBM50	3.37e-54	81	337	122	379
CEI62111.1|CBM50	1.34e-49	75	337	110	396
QKD60899.1|CBM50	5.42e-49	174	337	235	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2L9Y_A	1.33e-118	174	340	1	167	Solution structure of the MoCVNH-LysM module from the rice blast fungus Magnaporthe oryzae protein (MGG_03307) [Pyricularia oryzae 70-15]
5C8O_A	2.30e-104	174	340	4	154	Crystal structure of MoCVNH3 variant (Mo0v) [Pyricularia oryzae],5C8P_A Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)3 [Pyricularia oryzae],5C8Q_B Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)4 [Pyricularia oryzae]
3S3Z_A	1.45e-08	178	337	13	169	Crystal Structure an Tandem Cyanovirin-N Dimer, CVN2L10 [Nostoc ellipsosporum]
2L2F_A	4.49e-08	178	225	2	50	Chain A, Cyanovirin-N HOMOLOG [Fusarium graminearum]
2KJL_A	2.23e-07	179	225	5	53	NMR structures of a designed Cyanovirin-N homolog lectin; LKAMG [unidentified],3HNU_X Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG in P21 space group [Tuber borchii],3HNX_A Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG in P212121 space group [Tuber borchii],3HP8_A Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG, bound to sucrose [Tuber borchii],3HP8_B Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG, bound to sucrose [Tuber borchii]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00037441-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000087	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00037441-p1.