CAZyme Information: mRNA_M_BR32_EuGene_00037001-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00037001-p1
• CAZy Family: CBM50
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	BR32_scaffold00003|CGC16	24947.52	9.1575

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:1383758-1384544(-)

Full Sequence      

MHFTYGLTAVACLLGTALGQAKVKFMPLGDSITEITCWRATVWDNLVSAGLSSRTDFVGS
STTNPQNCQPRNGNWNRRHEGHSGYQAVDIVRNNLPGWLNQNVPDVVNFMLGTNDVNLGN
RQTSEILNAYTGIVQQLRAKNPRVKIMVDTVLPLPFKQAPITALNNAIPGWAAQLNTAQS
PIVVVDVAAGYPTSALRDQVHPNAAGDAIIAGKITPVLTRLIRDVIAEKGL

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00037001-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	23	212	4.5e-52	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	8.98e-39	23	218	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.83e-15	28	206	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.68e-12	28	217	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	5.10e-09	26	211	2	221	GDSL-like Lipase/Acylhydrolase.
238879	NnaC_like	3.49e-08	76	168	28	122	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60834.1|CE3	4.35e-168	1	231	1	231
AEO59370.1|CE3	4.53e-78	3	228	10	235
AEO64701.1|CE3	5.62e-74	22	227	30	235
VBB79507.1|CE3	3.60e-73	20	227	85	292
CDP27869.1|CE3	3.60e-73	20	227	85	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	4.83e-72	23	225	2	206	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	1.38e-71	23	225	2	206	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00037001-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999731	CS pos: 19-20. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00037001-p1.