CAZyme Information: mRNA_M_BR32_EuGene_00036741-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00036741-p1
• CAZy Family: CBM48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		48964.95	7.4818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:1309342-1310649(+)

Full Sequence      

MGSPRLLGSPLSPLSPKMGMGNLKPAISLRNRLPTQIRRCLPLYLACICIILLILNADIV
GISVPGTGVGGRGRGLAIRREAYKDYLSKGKKLQGAGSVPAKFPRKIWQTWKVDPMSFAE
RDSLTARTWTARNPNFRYEVLTDDNDMGYVEYHFGPDGFDRPDIVEFYRNVNATIIKADL
LRYIVMYAEGGVYADIDVEALKPVHRFIPERYNEEDIDLVIGVEIDQPQFRSHPILGSKS
QSFCQWTFMAKPRLTVMLNLIENIMSWLNDVAVEQGVGVSEVQLDFDKVISGTGPSAFTI
AVLEDMNMRMKLEEAGGRLAKRPSKSGKEITWDDFHDLDESKVVSRILVLDVEAFAAGQG
HSDSGNHNARGALVKHHYHASNWPSRHPRFSHPAYGEVERCNWDPVCVAKWDRDVAEFKS
LSSEEQQQRIASRQF

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00036741-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	125	209	1e-17	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.33e-20	101	268	80	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.76e-10	120	210	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60802.1|GT32	1.51e-314	1	435	1	435
UQC86260.1|GT32	7.02e-186	9	430	7	390
AEO66402.1|GT32	3.45e-180	7	425	5	385
UPL04319.1|GT32	5.33e-177	7	430	39	425
UKZ65216.1|GT32	3.92e-174	1	430	5	384

PDB Hits     

mRNA_M_BR32_EuGene_00036741-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.58e-28	101	383	140	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	7.14e-27	103	376	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.98e-26	102	350	129	356	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.75e-24	101	376	94	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999900	0.000114

TMHMM  Annotations     

Start	End
40	62