CAZyme Information: mRNA_M_BR32_EuGene_00036101-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00036101-p1
• CAZy Family: CBM18|CBM18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	BR32_scaffold00003|CGC8	42510.17	5.0955

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:1158639-1159849(-)

Full Sequence      

MVRKFTPCALLAAALGTAHAALLTFTAGESDFKLAATGLAPVIQVASNDWPAVKRVAQDL
AADFGRVVGTNGTISDSDSSSDGRPVVMVGTIGNSTLIDGLVSANKIDVSATAGKWESYV
SQLVKEPVEGVPWALVIAGSDRRGAVYGIYDVSEAMGVSPLYWWADVPVKTKPDGVWVTE
EKKVQGPPSVKYRGFFINDEAPALQSWINRNTGGFNSQFYRLVFELCLRLKGNFLIGLDI
WPAMWGRMFYVEDPKNGPLAEEFGVVMGTSHHEPMARSEEEQKRYNQGNWDWSSNRNSVT
NFFKDGISRARNWETMWTMGMRGSGDEASPTLNPQSLEQIIQVQQQLLSEAYGTTDMATI
PQTWVLYKVSFGFFMSSKLQYLMEH

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	30	371	5.2e-118	0.4375896700143472

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	4.15e-86	186	368	1	179	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60747.1|GH115	2.81e-265	1	374	1	374
QMW34550.1|GH115	4.06e-146	7	368	6	364
QMW46604.1|GH115	1.60e-145	7	368	6	364
UDD63493.1|GH115	1.76e-144	7	368	6	364
BAE56806.1|GH115	1.82e-144	7	368	6	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	5.24e-85	45	368	27	344	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	4.41e-81	25	368	37	374	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	7.56e-75	32	368	17	359	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	7.49e-74	32	368	16	358	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	7.05e-68	53	374	32	360	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00036101-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000335	0.999640	CS pos: 20-21. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00036101-p1.