CAZyme Information: mRNA_M_BR32_EuGene_00035641-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00035641-p1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1020	BR32_scaffold00003|CGC17	113325.99	5.9885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:1031177-1034420(+)

Full Sequence      

MSQDAASAPSDLGAQTQQPHQAGNGGTNSSHGTDNIAKRALKLGASTSLSPELPPTGLQE
EVPVTPGITTAAYHDFEFDNDESGGGPGYFSRRGQNMMTTPVGKGVEDDGLGPSASSSAP
DPEVLKRINQFRLGGRKESLTNIRAMNPDLSLSGNIISATFNIPYSLEYRKGADWVLNPR
RGQSALFDSLSHLSSDNTPWNHTVVAWTGEIEPPSDLPSPPATPPATTTNLPALNSLSKP
IPVNGEAPAPAPSHAEGLWIPREDQLRLESQLSHNAKIKTSAVWLSDSNEATEEGITLKD
QARWRRFAEHELYNLFHYKQHEPNDGRKERVQWADYYRMNQKFANKIIENYKPGDIVIIH
DFYLMLLPSMLRQRAPHIYIAFFLHSPFPSSEFFRCLPRRKEVLEGVLGSNMIGFQSYSY
SRHFSSCCTRILGYKSDARGVNVYGSRVEVGVFPIGIDAKKVEQLAWSDSVNKLVQQLQT
QTTQGRKLIVGRDRLDSVRGVAQKLKAFERFLENYPEWRDKVVLIQVTSPTSIEEEKDES
KVSTLVNELVLKINGMYGGLGFEPVRHFSQYIGQDEYFALLRGADIGLITSVRDGMNTTS
MEYVVCQRDSHGPLILSEFSGTAGSLTDAIHINPWDFSAVADEINRALTMPPHKRQEMQT
KLYEHVTTKTVHEWIGGVVAKLIQVLGSGQNPVKTPLLDRSALLRSYRAAGKRLFMFDYD
GTLTPIVREPSAAVPTERLLQTIKALAADDRNAVWVISGRDQDFLSAHLGHIQNLGFSAE
HGSFMKKPGSDEWENLADKFDMGWQEEVIAVFQKFTDKVEGPFIERKRCAVTWHYRPVVD
QDLAQRLARECHKELEATVARKWEVEVMPGKMNLEVRPTFINKGAIAKRLVLDYNAELVA
AGKNKLEFVLCMGDDFTDEDMFRSLNTLSVTADGATEPELKTEHVFSTTVGPSTKVTIAR
WHLLEPEDVVECVALLASGVSTELLANQGEGVAETVKPLRVSENNLAAISEVEGRVPDIE

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	150	682	4e-154	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	256	978	42	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	4.05e-179	250	675	36	455	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.79e-167	256	675	45	461	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	9.74e-148	250	675	52	470	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
274112	trehalose_OtsA	2.11e-134	307	674	84	446	alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., ). [Cellular processes, Adaptations to atypical conditions]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP29756.1|GT20	0.0	62	1018	39	997
VBB81574.1|GT20	0.0	62	1018	39	997
CAP65155.1|GT20	0.0	62	1018	12	970
UQC81490.1|GT20	0.0	64	1020	29	993
AEO60371.1|GT20	0.0	47	1018	32	1036

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	3.05e-134	114	683	10	524	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXN_A	6.78e-109	695	976	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	2.23e-104	695	976	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5HUV_A	4.70e-91	257	682	54	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	6.53e-91	257	682	54	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	9.67e-210	156	981	16	851	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	1.80e-196	129	978	16	814	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	6.42e-195	156	981	11	858	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	1.19e-149	156	971	17	844	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54NU9|TPSB_DICDI	2.00e-142	304	925	139	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00035641-p1.