CAZyme Information: mRNA_M_BR32_EuGene_00034791-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00034791-p1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1508	BR32_scaffold00003|CGC9	168132.64	5.0491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00003:832567-837228(+)

Full Sequence      

MIYLSRLPWGLRVSLLAALAQLQFVPLAAGAPSVEVSMQAAFPSPPYLLELLETAAQEND
TAYFPLLDRIASGHFAKASTDRELYEKFLQVLQEDGHITSPDALSTFKLALSMRSAAPRI
EAHYQHYRTAVEPKFQGKADSCPEWILKSGEIFCSIDETKGVANIVGDALSKDIPFDHQL
GDGSEGVILYADITSPSFGAFHDTLATAARNGGPSYRLRHRSITTASKQPLYLSGYGVEL
ALKRTDYIVIDDRANEKTTQDDSTQKPLVGGSSEIVLNGDEEVADLKPLSASELEELGLK
AADFILRGDRPFETLLKLTQDFPKYSASVSAHNVSTGFRTEHSANRMLLQIPSGSNILWM
NGVQLIERQIQSFGLVDVLRRERQLINEVRSLGLSGQEAVDLLSHSDVASSKASDEPARF
DWRDEKEDGKVIVWLNNLEKDKRYENYSPHIMTLLSGGIPGQLPPIRRNIFNIVLPVDFS
RASDMALATSQLIGFVKQRIPIRFGLVPLATTTEAEDQAKVVYHLLQTYGLSSLMAYLEL
CLDGSTTGPNQEAFDAAIKDRTVRSELTALSLKDVLASETYTNQVTLAKQWSSRLGAHSA
VPPLFVNGFALPRDSENRWMGMMSGRISGDLRSLQEGIYYGTINDETNVPEIFLADASSR
RNHYIFPENDNGLTILDVNKVYTDHDDLFTKAAVIESSPDFDREAWALLTVFVDLDSKDG
REILLSALRFRRSNPGVRLEIVHNAVKKTSHDINSNLKEQSDRLLAAESDEGLVAILEEI
RHAPQTNIGLEYAQALERFQRAAHFEPGTSILMLNGRVVGPIQSASEFSESDFQTFLEFE
QNSRIIPVYKALEELGLGDRLSDPVAAAKLTSITALSTISDLPDGAFENPPTLRISSFKL
WNSTHTGFEVGDPSKASIFFTAVIDPASELGQKWTPLLKVLSELDGVHLKVFMNPRDRLE
ELPVKRFYRFVMDSAPVFDEAGKLEVPSASFKGLPSEALLNLGMDVPPAWLVAPKVSVHD
LDNIKLSSVTSDVTAIYELENILIEGHARSTDSGTPRGVQLVLGTESNPRVADTIIMANL
GYLQFKANPGIYDITLEKGRSSDIFYVESIGAHGFSPVAGDETTEVALLDFLGTTLYPRL
RRNPGKENLDVLEESGAAPSGNAGGAMDFVNKGLKFAESLLGGAKGKAKEKSPSELQHAE
INIFSVASGHLYERMLNIMMVSVMRHTKHTVKFWFIEQFLSPSFKDFIPHMAAEYGFKYE
MVTYKWPHWLRQQKEKQREIWGYKILFLDVLFPLTLDKVIFVDADQIVRTDMYDLVQLDL
QGAPYGFTPMCDSRTEMEGFRFWKQGYWERYLKGLPYHISALYVVDLRRFRELAAGDRLR
QTYHTLSADPNSLSNLDQDLPNHMQFSIPIFSLPQEWLWCETWCSDDTQPMAKTIDLCNN
PMTKEPKLDRARRQVPEWNVYDAEIAAVDRKRKGLPVSGDAASEQAAKNPKSRTLAVEPE
NTHIVDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1201	1448	4e-134	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1201	1448	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1201	1468	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	2.33e-93	420	665	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	2.81e-65	677	875	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	2.41e-58	44	221	1	177	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60625.1|GT24	0.0	1	1508	1	1508
UPK89075.1|GT24	0.0	1	1508	1	1462
AEO67685.1|GT24	0.0	1	1470	1	1467
UQC87132.1|GT24	0.0	1	1508	61	1551
VBB81405.1|GT24	0.0	1	1508	1	1493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	29	1507	6	1485	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	29	1507	6	1485	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	29	1507	6	1485	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	29	1507	6	1251	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	32	1410	2	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	8.35e-262	31	1468	19	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	4.08e-237	38	1465	34	1504	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	9.47e-231	24	1465	37	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	1.00e-227	10	1465	20	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	1.10e-225	13	1465	25	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999709	CS pos: 30-31. Pr: 0.9695

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00034791-p1.