CAZyme Information: mRNA_M_BR32_EuGene_00028791-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00028791-p1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874		95332.94	9.5751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:3552883-3555929(-)

Full Sequence      

MRFNIILTMLVGVASCSSDGSENRHQHRHPHAAPAAHPAKRQVADSAPGARSTTPPQSVV
ASPTGSSPVTRPANEKPKATSVGVLITELEGGVAQIITARPGPPPDTKGTVITKLNTTGH
ATIAPLLTRPIPPVKERFEVDLQARSAAAIATRNPSPSRPAVARMAAPNIFAEPISTNPP
HAKFLRRDDHPVGRSSITSLAPYPTNKFFSNMYLGGMRSPAFLHPYSIQWAKGEGVTGSW
GFAISHTEPNQRVFGPPDPKTKASKYFINPIGIHSIVLSAQELGPQTQLAMTELCAFSAM
AELRATPGSQPTLKMPFVQGSGFITGIYNGASPIVSSGVYFRQVLRANQNPQPGVVKYKM
FLEDGKSWLLYARHTSGNPLILDVVDSKNFKAREPFWGTIQIAKEPGNGEAIYDQACGAY
ATSMELSGTTSGTSGSYTFTFKRAGLASSKLLMFALPHHADGFSEASRQAVTGLQLQTTT
KGLASGILADSWTIRETLTPGVGFLPWDRRRGEISKLGNSARIAVLRIAQQELAQNMIDQ
ANLDSMYFSGKALAKFASIIIVANDLLKNPEVAQTGLNQLKRAFAIFAENRQKFPLVYDT
RWGGIVSSASSSSLTITHPGNTYYNDHHFHYGYFVYTAAVIAHIDKAWGNANKEFVNTLV
RDFANPSAKDGFFTMYRNFDWYHGHSWAHGLYDTLDGNDQESSSEDAMSAYAVKMWGRAI
GDANMEARGELQLAAQARAFKYYYLYTSDNKVQPAEFVGNKVAGILFENKIDHTTFFGAN
IEFIQGIHMIPLMPFSPLTRSDQFVREEWATYFDNGRINEVQGGWRGILMGNYAQINPAM
AYSFFGSSKFDPGFLDGGASRTWYMAYSAALAGL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	196	867	1.4e-217	0.9790996784565916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	155	873	38	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	520	865	5	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	7.70e-129	190	508	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
223021	PHA03247	0.001	41	182	2649	2783	large tegument protein UL36; Provisional
223021	PHA03247	0.004	47	205	2610	2770	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62182.1|GH81	0.0	1	871	1	872
AEO64126.1|GH81	1.64e-313	68	874	73	875
CAP66697.1|GH81	1.94e-292	81	874	171	960
CDP28432.1|GH81	1.94e-292	81	874	171	960
AEO58881.1|GH81	1.09e-284	169	874	103	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.03e-88	204	853	42	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.34e-87	204	853	67	730	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.49e-85	204	853	42	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.38e-22	547	848	340	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.93e-20	547	791	361	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.88e-218	157	869	178	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	4.17e-166	174	873	6	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.84e-159	169	872	401	1113	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	4.47e-151	175	869	432	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.37e-146	169	871	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000167	0.999833	CS pos: 15-16. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00028791-p1.