CAZyme Information: mRNA_M_BR32_EuGene_00028601-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00028601-p1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		54645.79	4.3162

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:3497667-3500551(+)

Full Sequence      

MGTYTFKWPNAGESVFVTGTFDEWKKTVQLDKVGDNFEKTVTLPETTEKIYYKFVVDGQW
TVNQAAPKENDASGIENNVLTPEDIIKSAPAEAAIINSVAPEATTVALAADAPLEKKEDK
APAAETEGEMSKDSKDSPVPGAFPETPAAELEKEVKISPLPASDGAVNPIKLAPGEKIPE
EFKTADINANVKLDPESYEKADTLPGVSTTLPPVSSTMIPESSLPVAAANDVTVSSVGPE
STTVALAAEVPLEPKAPAIVKESQEKAGVDPEASAVSEEIKEKNEVEAELLSKVPEAPST
SEGTAGKGTEKSENDKTLAETAAATAAGVLSAAVAAKDSAVDQATAAAAQLPDSVKQSLP
ASVQSAIAPAAQESVRQEVSPEVPAEVKESIKEAGESPEAAANTAAVEEKKKIEAELLKE
VAPAPAVGEESKKVEEKAEEKAAETTDKAEEAKPATNGSSEPTTKVVKEPEPTATKAPET
PTKKTETPSTAASGDSPATAEKKKKNRFSTIINKVKSKLSSKDSK

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00028601-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199889	E_set_AMPKbeta_like_N	1.43e-25	3	81	1	79	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
406865	AMPK1_CBM	1.12e-22	5	86	4	85	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199892	E_set_Isoamylase_like_N	7.61e-06	3	81	4	85	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.
199878	E_set	7.64e-05	5	66	3	66	Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus. The E or "early" set domains of sugar utilizing enzymes are associated with different types of catalytic domains at either the N-terminal or C-terminal end. These domains may be related to the immunoglobulin and/or fibronectin type III superfamilies. Members of this family include alpha amylase, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. A subset of these members were recently identified as members of the CBM48 (Carbohydrate Binding Module 48) family. Members of the CBM48 family include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.
237284	PRK13108	1.80e-04	165	316	267	419	prolipoprotein diacylglyceryl transferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62198.1|CBM48	7.97e-256	1	525	1	525
CAP61721.1|CBM48	7.86e-98	1	321	1	332
CDP28069.1|CBM48	7.86e-98	1	321	1	332
VBB80536.1|CBM48	8.93e-98	1	321	1	331
UKZ62401.1|CBM48	5.66e-92	1	427	1	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Y0G_A	1.01e-08	7	80	16	87	beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) [Rattus norvegicus],4Y0G_B beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) [Rattus norvegicus],4YEE_A beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_B beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_C beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_D beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_E beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_F beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_G beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_H beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_I beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_J beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_K beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_L beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_M beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_N beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_O beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_P beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_Q beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_R beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus]
2F15_A	1.17e-08	7	80	15	86	Glycogen-Binding Domain Of The Amp-Activated Protein Kinase beta2 Subunit [Homo sapiens]
2LU3_A	1.46e-08	7	80	23	94	Solution NMR structure of the apo-form of the beta2 carbohydrate module of AMP-activated protein kinase [Rattus norvegicus],2LU4_A Solution NMR structure of the beta2 carbohydrate module of AMP-activated protein kinase bound to glucosyl-cyclodextrin [Rattus norvegicus]
4RER_B	6.56e-08	7	80	7	78	Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin [Homo sapiens]
4REW_B	8.87e-08	7	80	7	78	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZRR2|MDG1_YEAS7	7.01e-16	4	114	8	117	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MDG1 PE=3 SV=1
sp|C7GTE8|MDG1_YEAS2	3.03e-15	4	114	8	117	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain JAY291) OX=574961 GN=MDG1 PE=3 SV=1
sp|C8ZG55|MDG1_YEAS8	3.03e-15	4	114	8	117	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=MDG1 PE=3 SV=1
sp|P53885|MDG1_YEAST	3.03e-15	4	114	8	117	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDG1 PE=1 SV=1
sp|B3LP25|MDG1_YEAS1	5.44e-15	4	114	8	117	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=MDG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00028601-p1.