CAZyme Information: mRNA_M_BR32_EuGene_00024131-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00024131-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		47115.00	9.1666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:2236568-2238191(+)

Full Sequence      

MIATIAGPSPLWTIVRLFALWKGMLVLVAAGSALVGPAYDTSASLLLAPASNSSSSMFLA
RLSSWDAVYFVQQAQRGYVFEQEWAFGEGLPRIITRALRGLNSVGLLRDGGLEAIAMVGV
MVAHVSHLLSSLALFWLGALVLGDQRQALVAACLHVLSPAGLFLSAPYAEAGFSYLSFFG
LYLFAVSQSPDAAAYGGELKKDGAVLVSGFLLGRATTFRTNGLLNGVPFAYAFCRDCLRF
LSAPSLAGLRRIVVLGVAGLCIAAGSVWPQAVAYTRYCGDSLAEGLSRPEWCSQTIPSIY
SFVQRRYWGTGLFQYWTISNAPLFLLAAPMLYILIRSGWEMATASSGESAEGVKIAAKGD
MADLVKALAAAQIILAVTALTSYHVQIITRLSSGYAVWYWWLAQRLAGDKKAGGFGKGVV
TFMIMYAGIQAVLFSSFLPPA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00024131-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	14	441	5.6e-120	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	7.85e-43	39	441	27	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.08e-13	58	441	70	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62626.1|GT76	5.11e-300	1	441	1	441
VBB80094.1|GT76	4.62e-123	5	441	32	461
CDP28476.1|GT76	1.59e-121	5	441	34	463
CAP66741.1|GT76	1.59e-121	5	441	34	463
AEO58925.1|GT76	1.27e-116	8	441	18	458

PDB Hits     

mRNA_M_BR32_EuGene_00024131-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	3.30e-120	10	441	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.34e-101	10	441	10	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.92e-76	10	441	29	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	2.89e-74	9	441	17	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.36e-49	13	441	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999433	0.000568

TMHMM  Annotations     

Start	End
13	35
120	142
149	171
247	269
312	334
369	391
412	434