CAZyme Information: mRNA_M_BR32_EuGene_00023851-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00023851-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
182		19823.00	9.2063

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:2149367-2150007(-)

Full Sequence      

GYYGCRFTGFQDTVLANQGKQLYARCLVQGATDFVFGQYAAAWFEKNDVRVLGKSLGYIT
ANGRLDNSNPSYYVFNNCNVAAASGQSVPRGAYYLGRPWREFARVVFQNTAMTEVINSAG
WKTWNTGDERISNVLFGEYGNSGAGSQGQRASFSKKLGSAVGIDSILGSGHRSAAFYDGS
YM

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00023851-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	157	1.5e-51	0.5243055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	3.68e-36	2	161	154	311	probable pectinesterase
395871	Pectinesterase	1.89e-32	2	154	119	275	Pectinesterase.
215357	PLN02665	5.39e-32	2	157	191	340	pectinesterase family protein
178051	PLN02432	4.91e-31	2	160	125	275	putative pectinesterase
178372	PLN02773	1.96e-30	2	157	134	282	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62655.1|CE8	6.14e-131	1	182	144	325
QKD62636.1|CE8	1.20e-88	1	182	148	329
QGI88211.1|CE8	3.41e-88	1	182	148	329
QGJ01763.1|CE8	3.41e-88	1	182	148	329
CCT75603.1|CE8	3.41e-88	1	182	148	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.60e-40	1	168	129	288	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.60e-40	1	168	129	288	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	5.58e-23	2	146	126	273	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.06e-20	5	146	125	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	5.62e-64	1	182	151	331	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	9.20e-60	1	169	150	319	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|A1DBT4|PMEA_NEOFI	1.53e-40	1	173	154	318	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	6.16e-40	1	169	155	315	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|A2QK82|PMEA_ASPNC	2.52e-39	1	168	157	316	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000004

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00023851-p1.