CAZyme Information: mRNA_M_BR32_EuGene_00022741-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00022741-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46613.89	5.4514

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:1814122-1815357(-)

Full Sequence      

MLQFLFIGFLFAGGYFHYMWKAEAAIGVPWEPDLGSRQFAQRPLLPPIANTFIDTYELPL
SAKGRDVVDSKGRRFKLSSVNWYGASDELFVPSGLDMQHRDVIAQTIRRMGFNSVRLPYA
DEMVIANPPILPHLVSQNPDLIGRRALDVFEAVVTALTDAGIAVIINNHITHATWCCGAD
PCDAGWANDHLGPLCRVSQTEDDWIAHWETVMSRFTENPRVIGADLRNEVRGVWGTMTWD
RWATAAERCANRLLKMNSDWLMIVGGTESGNDLRGARDRPVRLDVDDRVVYSAHVYAWSG
WGSREGRYSKRPYPSFVASMRENWAYLVEGDVAPVWVGEFGAPAHPSVGDANYWQNLMRY
LKAIDADFGYWAINPRKPKDDAKETYSLVEDDWVTPILDYRMKDMTELMRA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00022741-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	67	379	3.2e-157	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.93e-29	103	375	29	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.29e-17	100	400	76	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62768.1|GH5_24	0.0	1	411	1	411
UQC80596.1|GH5_24	3.46e-250	3	411	105	513
CAP59961.1|GH5_24	1.24e-232	7	410	6	426
CDP22603.1|GH5_24	1.24e-232	7	410	6	426
VBB71617.1|GH5_24	3.54e-232	7	410	6	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	4.15e-44	64	395	10	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	8.10e-44	64	395	10	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
3VVG_A	5.03e-29	77	395	30	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	1.31e-28	77	395	30	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.43e-28	77	395	63	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	2.37e-46	63	395	42	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	8.01e-42	64	395	51	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	1.30e-32	55	393	26	379	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P10474|GUNB_CALSA	3.62e-30	54	395	624	984	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	3.47e-28	60	395	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.563751	0.436256

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00022741-p1.