CAZyme Information: mRNA_M_BR32_EuGene_00018811-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00018811-p1
• CAZy Family: AA5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		32552.37	4.3218

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:782278-783291(+)

Full Sequence      

MPSKLTVLASGALLLTSVGSAAVPCSSPQYLVTFGDSYSQTGFNTSLAKPTASNPLGNPA
LPGWTSSGGLNYVGQLAGKAVGNGGAAPVLSYNFADGGATTDSAIVAPYTPTVRSFVDQV
AVFEQTLGARPRPEGWADWTAEDALFGVWMGVNDVGNSHWLANATDVVDALTLRYFDGLD
ALYEAGGRNFYLLTVPPTERSPLMMSSNSSPTLVPMLEYYRNSISSQLAVWETSHDDADV
RIVDSVPAFNIPLDDPTSYGAPDASCYGAPGTAEGGKSCLWFNDYHPAIEIHKMVAKAVA
DAWKGRFF

Enzyme Prediction     

EC	3.1.1.6:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	31	299	1.2e-95	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.03e-58	30	302	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	6.10e-14	1	300	1	330	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	2.53e-08	28	301	1	279	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238875	SGNH_plant_lipase_like	5.06e-08	34	287	6	299	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63135.1|CE16	7.16e-226	1	308	1	308
AEO68387.1|CBM1|CE16	2.06e-96	29	308	116	385
AGW01024.1|CE16|3.1.1.6	7.66e-95	8	308	5	302
AEO59602.1|CE16	7.66e-95	8	308	5	302
CCT69184.1|CE16	4.32e-88	1	308	1	296

PDB Hits     

mRNA_M_BR32_EuGene_00018811-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	1.36e-95	8	308	5	302	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	1.36e-95	8	308	5	302	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999732	CS pos: 21-22. Pr: 0.9795

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00018811-p1.