CAZyme Information: mRNA_M_BR32_EuGene_00018021-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00018021-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	BR32_scaffold00002|CGC8	54109.24	9.5881

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:532343-534037(+)

Full Sequence      

MSPSRTPSPVPGGGWSSPGLNSGRSSPSRGVAGSTGGHSPIIWEGSRVNQNGGSGKGGPS
SGFRATNAGTNQRGIMGHVRRLSSGLPMWNNGKTVKSAYSNKDKGAGQKWYNPNRLPLVA
RARRGYARMNRTAKTVLWALVLLGLCLYVFYHSPLVYHWRRSSMLGGGEKVVIILAANIG
GGVMEWKGAREWAIERDSVRNKKKYAATWGYDLEIVDMSTKKRYAHEWRESWEKVDFMRS
CMKKYPKAEWFWWLDLNTYVMEPSYSLQEHIFDNLQQHVYRDINEYNPLNITHPPNDPFL
DEESRSAVGDGRPESVNLILSQDCSGFNLGSFFMRRSDWTDRLLDVWWDPVAYEQKHMEW
AHKEQDALEQLYVALPWVRKHTGFLPQRMINSFPSGACSDKGPDTRIHYDQKDRDFVVNM
AGCEWGRDCWGEMYHYRELSYYLNRTWWERFKEDLLCAIWFKLTGQKVKF

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00018021-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	169	431	7.2e-87	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	9.04e-78	169	429	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63203.1|GT34	0.0	1	470	72	541
VBB72694.1|GT34	3.84e-238	1	469	1	460
CAP69563.1|GT34	7.75e-238	1	469	1	460
CDP23580.1|GT34	7.75e-238	1	469	1	460
AEO65857.1|GT34	2.45e-233	1	470	1	457

PDB Hits     

mRNA_M_BR32_EuGene_00018021-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	5.19e-107	161	451	112	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	1.12e-87	119	440	27	334	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|Q09174|GMA12_SCHPO	1.14e-25	199	429	128	339	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|O94622|YBKD_SCHPO	1.36e-24	196	423	125	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q10359|GMH3_SCHPO	8.66e-20	199	423	112	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999685	0.000346

TMHMM  Annotations     

Start	End
136	158