CAZyme Information: mRNA_M_BR32_EuGene_00018011-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00018011-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		36754.00	7.1188

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00002:527491-528624(+)

Full Sequence      

MFSRRSKFSLASAFFLASFLFLFIHTYRYGSPEKAGLGGLLSRPFGGEAKAPRPQGTKDK
DDNGIPKKLWFKLGPKGLDDNTRAWSDSCIKANPTYKVSFMNDATADKWVEENFGKTHPD
LVELYQALTVPIFKADILRYLFLFVEGGVYLDLDVSCDRPIEEWIPAQHKGKVSVVAGWE
FDVGWGDNFVRQFATWTIMAKPNLPHIWNVVHDIEKTMRDKVREKNLDSPANLTMALLGD
VVDVTGPRRFTRSVLDNLERSGDKPADMTPYEKLLEPKLLGDLLIMPGWAFAASSNTYDE
SFPKPPPMVTHHYAGSWKNDKGGETL

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00018011-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	85	167	2.9e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.33e-17	65	320	82	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.80e-14	87	166	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63204.1|GT32	4.10e-250	1	326	1	326
CAE7026497.1|GT32	2.05e-99	52	324	39	311
QQK44540.1|GT32	2.31e-97	6	325	9	318
CAE7002672.1|GT32	7.69e-95	59	326	66	334
AEO55037.1|GT32	9.91e-91	93	324	2	230

PDB Hits     

mRNA_M_BR32_EuGene_00018011-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.75e-28	65	320	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.38e-25	28	320	74	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.56e-23	74	319	143	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.38e-12	65	217	96	285	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5UQW4|YL373_MIMIV	3.37e-09	69	165	9	101	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

Start	End
7	29