CAZyme Information: mRNA_M_BR32_EuGene_00013011-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00013011-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1014	BR32_scaffold00001|CGC19	106460.94	4.8317

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00001:3860747-3864345(+)

Full Sequence      

MTLLSLVFLASLSNAAIIPRLPPPEVLPAGWDYMGCYVDIGRSLGAAATSSGLMTAEACI
NFCTSKGMQFAGTEYHNECYCDSSLPSAATLVADSECSTACSGDATQSCGGPSRLTVYHS
AQPVGPQPNPGVNGFNHIGCYTQVPQLRTLIRREGTTSRALPVAGDVPSAEVTAATCTAS
CLAKGFKLAGVEYGGECYCGNSLSAGSVPAAGGCNTLCNGNSSEICGGPNRLNLYNWHEN
ELPTASVPPTPSTTTSAATGPGSTAPPPPVVSDLPEGFEYHGCWIDGPNGRALPDYQAPD
SQTLTQESCAQICSQRGYTISGSEYSTQCFCANAIYNGGSKTTEAECSMPCSGNPAQKCG
AGNRLTIFSRGEPQVFLPPAPQTGGLGSWTYQGCYQDNLNDKRTFYWQLSFPNVMTPKMC
LDRCAKYGYMAAGLEYGNECYCGDPQNVVTAGVATPRPSTECNVPCDGNRTAICGGGSRL
STYFWTGTPFYSWTFPQTPATAGRYDLLIDAPTIALMTQESITGKVTFLSKWGTGPGSET
GAYELDVSMIPTNPAGAWRTLHVKTDIFCSAGVILPDRGARQLNVGGWSGESTEGLRLYW
PDGAPGTPGVRDFQENVQELSLQKGRWYPTAMVMANGSVMVIGGQVGSNGAAVPSIEVLP
HAPGSAPLYMDWLDRTNPDNLYPFVAVLPGGGILVTYYNEARILDEVTFNTIKQLPKIPG
AVNNDLAGRTYPLEGASVLLPQKAPYTAPLGILVCGGSSNGAANALDNCVSIYPEAANPE
WVIERMPSFRVMPCMASLPDGTYFIGNGALHGVAGFGLGVGPNLNSLLYDPEKPVGSRIT
VAANTTIARMYHSEALTLLDGRVLISGSDPEDGVNPQEYRTETYTPPYLLSGKPRPSFTI
VNKDWGYGANVAFSLGSAARNGAITVTLLGAVSSTHGNSMGARTLMPAVTCTGTSCTVQA
PPNAHVCPPGWYQFFVLDGGIPAVGVYIRIGGDPAGLGNWPPGNTFTKPGVGPV

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00013011-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	497	1007	4e-146	0.38095238095238093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	5.35e-26	890	990	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	6.85e-26	901	990	1	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
396406	WSC	6.15e-24	34	111	1	80	WSC domain. This domain may be involved in carbohydrate binding.
399910	Glyoxal_oxid_N	2.34e-22	544	757	50	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
396406	WSC	2.24e-21	281	361	1	80	WSC domain. This domain may be involved in carbohydrate binding.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56483.1|AA5_1	0.0	1	1014	1	1014
AEO53498.1|AA5_1	0.0	20	1011	25	988
AEO70370.1|AA5_1	0.0	12	1011	15	1116
CAP60434.1|AA5_1	0.0	2	1011	8	1130
CDP23078.1|AA5_1	0.0	2	1011	8	1130

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FWW_B	1.30e-07	34	118	91	178	Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) [Homo sapiens]
7BZT_E	2.02e-07	34	118	100	187	Chain E, KRM1 [Homo sapiens],7BZU_E Chain E, KRM1 [Homo sapiens]
6SNW_E	2.05e-07	34	118	103	190	Chain E, Kremen protein 1 [Homo sapiens]
5FWS_A	2.24e-07	34	118	131	218	Wnt modulator Kremen crystal form I at 1.90A [Homo sapiens],5FWT_A Wnt modulator Kremen crystal form I at 2.10A [Homo sapiens],5FWU_A Wnt modulator Kremen crystal form II at 2.8A [Homo sapiens],5FWV_A Wnt modulator Kremen crystal form III at 3.2A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF1|WSCD1_ARTBC	0.0	128	1011	56	924	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	1.02e-53	559	990	87	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	5.77e-50	556	990	166	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	1.65e-47	558	990	139	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|Q01772|GLOX_PHACH	6.28e-42	525	1002	63	556	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999706	CS pos: 15-16. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00013011-p1.