CAZyme Information: mRNA_M_BR32_EuGene_00010101-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00010101-p1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	BR32_scaffold00001|CGC7	47996.80	8.7475

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00001:2986252-2987577(+)

Full Sequence      

MVNPQYLGSVAARALVYFSARPTSNTQPSNNQLVSTQPSSSNGTNLGTQILAADKGTYSQ
NTASAVTALQGWYNKDTGLWKTTGWWNAANCLQVLMDFTLYDRAQSDSLGLRGVASNTFT
QAQQNTAMARKVMQVDTGMVVSAYEPLLNGMAKRGKEFQKLAKRQGFGGFINDFYDDEGW
WALAWIRSYDNYKDPGHLDIAENIFEDMRLGGDNTCGGGIWWSKQRNYKNAIANQLYLAV
AASLSNRAGTKKSSSYYRDIAVKQWAWLKGSGMINKDNLFNDGLTIHPNGSCTNNGMQTW
TYNQGVVLGGLVELSTQTGDKTLIDDAYRIATAAVTKMTTSAGILKESCEPGNCGGDGPQ
FKGVLARNIRQLVLAADSHANRAMLRDFLLRNADSVWAKDRNPANNQLGIVWSGPYNAGK
EPSADTQSSAMDVLVAAMAVA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00010101-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	59	438	6.2e-100	0.9357541899441341

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.22e-35	172	424	83	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.34e-20	163	397	79	307	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56212.1|GH76	0.0	1	441	1	441
AEO70866.1|GH76	1.55e-116	97	440	33	356
EAA32525.1|GH76	5.55e-114	8	438	7	415
APA06403.1|GH76	4.57e-110	53	440	15	396
QPG94943.1|GH76	2.35e-108	47	440	23	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.28e-18	170	423	129	368	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
3K7X_A	2.13e-18	163	418	79	326	Chain A, Lin0763 protein [Listeria innocua]
6Y8F_A	2.50e-17	170	423	130	369	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.46e-16	170	423	130	369	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4C1S_A	1.90e-07	174	331	106	265	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	3.42e-15	176	424	122	384	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00010101-p1.